SecReT6
Protein ID: 161526094
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2925
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3200421..3201521 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDA9AK60
KEGG IDbmu:Bmul_2925, bmj:BMULJ_00309
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-95, Aligned region: 18..347
Protein Sequence: 366 a.a.     [Download]
>gi|161526094|ref|YP_001581106.1| type VI secretion protein [Burkholderia multivorans ATCC 17616]
MQAPHRRIDSGVVDTLLDEPHRFEFFQAVRVLEGLFARQAADAPGAWRQGDVVAHRIAFRNTLSLGFPPS
EIEGARSFDDDGLPLDSAEQREAAVAGGELGRVELTPAFFGLLGAQGALPLHYTEQIAAREHLKRDHAAR
AFFDVFSNRATALFYAAWKKYRLPFHYELDRDERYLPLLLAIAGVPSDDVRDSLAAGAGGVLDEAVAGYA
LAARHRPMSAAYLQRTLSDYFRVPVKIDQFVGKWYDVPPDQLSVLGQVNAVLGATALVGERVWQRDMRAR
IVIGPLSKRDYEAFLPGGAQAVALERMLTLLAGVTLEYEVKLVLKRTEVGASVLGAGSRLGWDAFLCTRD
ADEDRSDARYELHVIH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|161523180|ref|NC_010084.1|:c3201521-3200421 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGCAAGCCCCGCACCGGCGAATCGATTCTGGCGTAGTCGATACGCTGCTCGACGAACCGCACCGCTTCG
AATTCTTCCAGGCGGTACGCGTGCTCGAAGGGCTGTTCGCGCGGCAGGCCGCCGATGCGCCCGGCGCGTG
GCGGCAAGGCGACGTCGTCGCGCACCGGATCGCGTTCCGCAATACGCTGTCGCTCGGCTTTCCGCCGAGC
GAGATCGAAGGCGCCCGCTCGTTCGACGACGACGGCCTGCCGCTCGACTCGGCCGAGCAGCGCGAAGCGG
CGGTCGCGGGCGGCGAGCTCGGGCGCGTCGAACTGACGCCGGCGTTCTTCGGGCTGCTCGGCGCGCAGGG
CGCGCTGCCGCTGCACTACACGGAACAGATCGCGGCGCGCGAGCATCTGAAGCGCGACCATGCGGCGCGC
GCATTCTTCGACGTGTTCTCGAACCGCGCGACCGCGCTGTTCTACGCGGCGTGGAAGAAATACCGGCTGC
CGTTCCACTACGAGCTCGATCGCGACGAGCGCTATCTGCCGCTGCTGCTCGCGATCGCGGGCGTGCCGAG
CGACGACGTGCGCGACAGTCTCGCGGCAGGCGCGGGCGGCGTGCTCGACGAAGCTGTCGCCGGCTATGCG
CTCGCCGCGCGGCACCGGCCGATGTCGGCTGCCTATCTGCAGCGCACGCTGTCCGACTATTTCCGCGTGC
CGGTGAAGATCGATCAGTTCGTCGGCAAGTGGTACGACGTGCCGCCCGATCAGCTGAGCGTGCTCGGCCA
GGTCAACGCGGTGCTCGGCGCGACGGCGCTGGTCGGCGAACGCGTGTGGCAGCGCGACATGCGCGCGCGG
ATCGTGATCGGCCCGCTGTCCAAGCGCGACTACGAGGCGTTCCTGCCGGGCGGCGCGCAGGCCGTTGCGC
TCGAGCGGATGCTGACGCTGCTCGCCGGCGTCACGCTCGAATACGAAGTGAAGCTCGTGCTGAAGCGGAC
CGAAGTCGGCGCGAGCGTACTCGGCGCCGGCTCGCGGCTCGGCTGGGACGCGTTCCTCTGCACGCGCGAC
GCCGACGAAGACCGGTCCGACGCGCGCTACGAGCTGCACGTGATTCACTGA