SecReT6
Protein ID: 161526096
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2927
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3203399..3203884 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDA9AK62
KEGG IDbmj:BMULJ_00307, bmu:Bmul_2927
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.40E-22, Aligned region: 29..137
Protein Sequence: 161 a.a.     [Download]
>gi|161526096|ref|YP_001581108.1| type VI secretion system lysozyme-like protein [Burkholderia multivorans ATCC 17616]
MKRFEPSFLDKLFDDEPHLPASAAMRQLSLDELKNTVARDVEAILNTRIAHTETELATLPECQKSVLTYG
LNDFAGLSLASHYDRAFICKSIQQAIARHEPRLQQVQVTFELNEQSTNALYFAIQALLVVHPAEEPVSFD
AMLQPSTLQYSVTRARTARML
 
Nucleotide Sequence: 486 bp     [Download]
>gi|161523180|ref|NC_010084.1|:c3203884-3203399 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAAACGCTTCGAACCCAGTTTTCTCGACAAGCTGTTCGACGACGAACCGCATCTGCCGGCCTCGGCCG
CGATGCGGCAATTGTCGCTGGACGAGCTGAAGAACACGGTCGCCCGCGACGTCGAGGCGATTCTCAATAC
CCGTATCGCACACACCGAAACCGAGCTGGCCACGCTGCCGGAATGCCAGAAGTCGGTGCTGACTTACGGG
CTCAACGATTTCGCGGGGCTGAGCCTCGCCAGCCACTACGATCGCGCATTCATCTGCAAGTCGATCCAGC
AGGCGATCGCACGCCACGAGCCGCGGCTGCAGCAGGTGCAGGTGACGTTCGAGCTGAACGAGCAGTCGAC
CAACGCGCTCTACTTCGCGATCCAGGCGCTGCTCGTCGTGCATCCGGCCGAAGAGCCGGTCAGCTTCGAC
GCGATGCTGCAGCCTTCGACGCTCCAGTATTCGGTCACGCGCGCGCGCACTGCACGCATGCTGTAA