SecReT6
Protein ID: 161526097
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2928
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3203947..3204450 [-]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDA9AK63
KEGG IDbmj:BMULJ_00306, bmu:Bmul_2928
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-44, Aligned region: 6..139
Protein Sequence: 167 a.a.     [Download]
>gi|161526097|ref|YP_001581109.1| Hcp1 family type VI secretion system effector [Burkholderia multivorans ATCC 17616]
MLHMHMQFGSPAIKGESADKDHQGWIELKSWDHSIIQPRSATASTAGGHTATRCEHGDMIFTKEIDSSSP
LLYQHASGGTTFDEVTIHFSRADGEGKRVQYLEIKLKYVIISSIAPSVREEGLPVETFSLKYAAVQWKQT
QQKIGGNQGGNTQGAWSLTKNDKTYAV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|161523180|ref|NC_010084.1|:c3204450-3203947 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGTTACACATGCACATGCAGTTTGGTAGTCCGGCGATCAAAGGCGAATCCGCGGACAAGGACCACCAGG
GCTGGATCGAACTGAAATCGTGGGATCACTCGATCATCCAGCCGCGTTCGGCGACCGCGTCGACCGCAGG
CGGCCACACCGCCACGCGTTGCGAGCACGGCGACATGATCTTCACGAAGGAAATCGATTCGTCGAGCCCG
CTGCTGTATCAGCACGCGTCGGGCGGCACGACGTTCGACGAAGTGACGATTCATTTCTCGCGTGCGGACG
GCGAAGGCAAGCGTGTCCAGTATCTGGAAATCAAGCTCAAGTACGTGATCATCTCGAGCATCGCGCCGAG
CGTGCGCGAGGAAGGCCTGCCGGTCGAGACGTTCTCGCTGAAGTATGCGGCCGTGCAGTGGAAGCAGACG
CAGCAGAAGATCGGCGGCAACCAGGGCGGCAACACGCAGGGCGCCTGGAGCCTGACGAAGAACGACAAGA
CCTACGCGGTCTAA