SecReT6
Protein ID: 161526098
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2929
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3204522..3206012 [-]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDA9AK64
KEGG IDbmu:Bmul_2929, bmj:BMULJ_00305
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-191, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|161526098|ref|YP_001581110.1| EvpB family type VI secretion protein [Burkholderia multivorans ATCC 17616]
MNQQTAPAQASGAEYAAGTSLLDEIVEKSKVAKSDSEHARAKDLIGELVHQVLDGTVVVSDNLSATIDAR
VAELDRLISAQLSAVMHAPEFQRLESTWRGLDYLVKESNTGQTIKIKALHAPKRDLVRDFKGASEFDQSA
LFKKVYEEEFGTFGGSPFGALIGDYEISRQPEDMYFIEQMSHVAAAAHAPFIASASPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGQTAETFNFVEDVDGTDHDKYLWCN
AAWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEVALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEIPGKPGSYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|161523180|ref|NC_010084.1|:c3206012-3204522 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTCCGGCCCAAGCGAGCGGCGCGGAATACGCCGCCGGGACTTCGCTGCTCGACG
AAATCGTCGAGAAGAGCAAGGTCGCGAAATCCGATTCCGAGCATGCGCGCGCGAAGGACCTGATCGGCGA
ACTCGTGCACCAGGTGCTCGACGGCACGGTGGTCGTGTCGGACAACCTGTCGGCGACGATCGACGCGCGC
GTCGCGGAGCTCGATCGGCTGATCTCGGCGCAACTGTCCGCGGTGATGCACGCGCCGGAATTCCAGCGCC
TCGAAAGCACGTGGCGCGGGCTCGACTATCTGGTCAAGGAAAGCAACACGGGCCAGACGATCAAGATCAA
GGCGCTGCACGCACCGAAGCGCGACCTCGTGCGCGACTTCAAGGGCGCCAGCGAGTTCGACCAGAGCGCG
CTGTTCAAGAAGGTCTACGAAGAAGAGTTCGGCACGTTCGGCGGCTCGCCGTTCGGCGCGCTGATCGGCG
ACTACGAGATCTCGCGTCAGCCGGAAGACATGTACTTCATCGAGCAGATGTCGCACGTCGCGGCGGCCGC
GCACGCGCCGTTCATCGCGTCGGCGTCGCCGGAGCTGCTCGGCCTCGAATCGTTCGCCGATCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGACACGGTCGAATACGCGAAGTGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCCTCGGCCGCCTGCCGTTCAATCCGAAGGACGGCCA
GACCGCGGAAACCTTCAACTTCGTCGAAGACGTCGACGGCACCGACCACGACAAGTATCTGTGGTGCAAC
GCCGCGTGGGCATTCGCCGCGCGGCTGACGGCCGCATTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTCGAGGGCGGCGGGCTCGTCGAGGATCTGCCGACGCACACCTTCAAGACCGACGACGGCGAAGTCGC
GCTGAAGTGCCCGACCGAGATCGCGATCACCGATCGCCGCGAGAAGGAGCTGAGCGATCTCGGCTTCATC
CCGCTCGTCCATTGCAAGAATTCTGATTACGCCGCGTTCTTCGCTGCGCAATCGGTGCAGAAACCGAAAA
AATACAGCACCGACAGCGCGAACGCGAACGCCGTACTCTCTGCCCAGCTTCAGTACATCTTCTCGGTATC
GCGCGTTGCGCATTACCTGAAGGCGATGATGCGGGACAAGATCGGCAGCTTCGCGTCGGCGCAGAACGTG
GAGACCTTCCTCAACCGGTGGATTTCGCAATACGTGCTGCTCGACGACAACGCGACGCAGGAGCAGAAGG
CGCAATTTCCGCTGCGCGAGGCATCCATACAAGTATCGGAGATTCCGGGCAAGCCGGGCTCGTATCGTTC
GGTCGCATTCCTGCGCCCGCACTTTCAGCTCGACGAACTCTCGATTTCTCTGCGACTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA