SecReT6
Protein ID: 161526099
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2930
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3206028..3206543 [-]
Producttype VI secretion protein
NoteTssB
UniProt IDA9AK65
KEGG IDbmu:Bmul_2930, bmj:BMULJ_00304
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.70E-59, Aligned region: 11..163
Protein Sequence: 171 a.a.     [Download]
>gi|161526099|ref|YP_001581111.1| type VI secretion protein [Burkholderia multivorans ATCC 17616]
MAKKESIQKSLQKIRPPRVQLTYEVEKGDAIEVKELPFVVGVVADLAGQSEVEQPKLRDRKFVNIDRDNF
DDVMKAIEPRAAFQVENRLSPEGGKFAVDLKFRSLSDFNPDEVVEQVEPLRRLLEARSKLADLRNKLAGN
DKLEDLLSEVLKNTQQLQALAKGTGGDKDGE
 
Nucleotide Sequence: 516 bp     [Download]
>gi|161523180|ref|NC_010084.1|:c3206543-3206028 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGGCCAAGAAAGAGAGCATTCAGAAAAGCTTGCAGAAAATACGGCCGCCGCGCGTCCAGCTGACCTACG
AGGTCGAGAAGGGCGATGCGATCGAGGTGAAGGAGCTGCCGTTCGTCGTCGGGGTCGTCGCGGATCTGGC
CGGCCAGTCCGAAGTCGAGCAGCCGAAGCTTCGCGATCGCAAATTCGTCAACATCGATCGCGACAATTTC
GACGACGTGATGAAGGCGATCGAGCCGCGCGCGGCGTTCCAGGTGGAAAACCGGCTGAGCCCCGAGGGCG
GCAAGTTCGCGGTCGACCTGAAATTCCGTTCGCTGTCGGATTTCAATCCGGACGAAGTCGTCGAGCAGGT
CGAGCCGCTGCGCCGCCTGCTCGAGGCGCGCTCGAAGCTCGCCGACCTGCGCAACAAGCTCGCCGGCAAC
GACAAGCTCGAGGACCTGCTGTCCGAGGTGCTGAAGAACACGCAGCAGCTGCAGGCGCTCGCGAAGGGCA
CGGGCGGCGACAAAGACGGCGAATGA