SecReT6
Protein ID: 161526102
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2933
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3208301..3209647 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDA9AK68
KEGG IDbmu:Bmul_2933, bmj:BMULJ_00301
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.60E-135, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|161526102|ref|YP_001581114.1| type VI secretion protein [Burkholderia multivorans ATCC 17616]
MSYSAKVLWGEGLFLRPQHFQRQDAYHEARLFESIQAIQPYNWGLRTLRIDHDALGSNVLRVAELALVFP
DGTLYAAPQGDDLPPPIALDTLPDGINEFVFYLALHPLRENGTNYSDDPAAGFTTRFVSQQTSVADNFTD
AAEADITFLKTQVKLIAHSEPRDQLLSVPLVRVRRTATSGFEVDDSFVPPCLAIEASPILHQRLRQLVDA
LQAKVNALYGFHREPSKNIIEFRSGDIASFWLLHTANAAFATLAHLHQHAALHPERLFQELLRLAGQLMT
FSKGYSLADLPVYRHDDPGPGFARLDVMLRELLGTVISTRYFAITLDEVRPSFHLGRLDSGKIDDKTEFY
LAVSADMPSVELVDAVPARFKVGAPDDVDKLVLSAMPGVRLSYTPQVPPAIPVRPGACYFALDSRGALYE
RMLQAQSAMIYAPTGINDLKFELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|161523180|ref|NC_010084.1|:3208301-3209647 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAGTTATTCGGCCAAGGTGCTGTGGGGAGAAGGGCTGTTCCTCCGGCCTCAACATTTTCAGCGGCAGG
ACGCGTACCACGAGGCGCGCCTGTTCGAATCGATCCAGGCGATCCAGCCGTACAACTGGGGGCTGCGCAC
GCTGCGGATCGACCATGACGCGCTCGGCAGCAACGTGCTGCGCGTCGCCGAACTCGCGCTCGTGTTCCCC
GACGGCACGCTGTACGCGGCGCCGCAGGGCGACGATCTGCCGCCGCCGATCGCGCTCGACACGCTGCCCG
ACGGCATCAACGAATTCGTGTTCTATCTGGCGCTGCACCCGCTGCGCGAGAACGGCACCAACTACAGCGA
CGATCCGGCCGCCGGCTTCACGACGCGCTTCGTCAGCCAGCAGACCAGCGTCGCCGACAACTTCACCGAC
GCGGCCGAAGCCGACATCACGTTCCTGAAGACGCAGGTCAAGCTGATCGCGCACAGCGAGCCGCGCGACC
AGCTGCTGTCCGTGCCGCTCGTGCGCGTGCGGCGCACCGCGACGTCCGGATTCGAGGTCGACGATAGCTT
CGTGCCGCCGTGCCTGGCGATTGAGGCATCGCCGATTTTGCATCAGCGGCTGCGCCAGCTCGTCGACGCG
CTGCAGGCGAAGGTCAATGCGCTGTACGGCTTTCATCGCGAGCCGTCGAAAAACATCATCGAATTCCGCT
CGGGCGACATTGCGTCGTTCTGGCTGCTCCACACGGCGAACGCCGCGTTCGCGACGCTCGCGCACCTGCA
TCAGCACGCGGCGCTGCATCCCGAACGGCTGTTCCAGGAGCTGCTGCGGCTCGCGGGACAGCTGATGACG
TTCTCGAAAGGCTATTCGCTCGCCGATCTGCCCGTCTATCGCCACGACGATCCGGGCCCCGGCTTCGCGC
GTCTGGACGTGATGCTGCGCGAACTGCTCGGCACCGTGATCTCGACGCGCTACTTCGCGATCACGCTCGA
CGAGGTGCGGCCGTCGTTCCATCTCGGCCGGCTCGACTCGGGCAAGATCGACGACAAGACCGAGTTCTAT
CTCGCCGTATCCGCCGACATGCCCAGCGTCGAGCTCGTCGATGCCGTGCCTGCGCGCTTCAAGGTCGGCG
CGCCGGACGACGTCGACAAGCTCGTGCTGTCCGCAATGCCGGGCGTACGGCTCTCGTACACGCCGCAGGT
GCCGCCCGCGATTCCGGTGCGGCCGGGCGCGTGCTACTTCGCGCTCGATTCGCGCGGCGCGCTGTACGAG
CGCATGCTGCAGGCCCAGTCCGCGATGATCTACGCGCCGACTGGCATCAACGACCTGAAATTCGAACTGA
TCGCGGTCACATCATGA