SecReT6
Protein ID: 161526103
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2934
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3209644..3210426 [+]
Producthypothetical protein
NoteTssL
UniProt IDA9AK69
KEGG IDbmj:BMULJ_00300, bmu:Bmul_2934
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.10E-57, Aligned region: 30..231
Protein Sequence: 260 a.a.     [Download]
>gi|161526103|ref|YP_001581115.1| hypothetical protein Bmul_2934 [Burkholderia multivorans ATCC 17616]
MSYAPSLFGDNAPTPVHTPSSTDAAFQARSLLDLLYDGFFMLFLLKNGREPESASEFSTRIQEFLSDFER
GAKKLNIAAEDVYGAKFAYCAAVDEMVLSSQFKIRADWERRPLQLVLFGEQLAGEKFFQYLEECRAQGAA
RLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIAHMKGKRAPFAPHWPLPDRIAHRLKREVPVW
AIGAVFALVALLGYLGLNAYLKGKTLQALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 783 bp     [Download]
>gi|161523180|ref|NC_010084.1|:3209644-3210426 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAGCTACGCGCCTTCCCTGTTCGGCGACAACGCGCCGACACCCGTGCATACCCCGTCGTCGACGGACG
CCGCGTTTCAGGCGCGTTCGCTGCTCGATCTGCTGTACGACGGCTTTTTCATGCTGTTTCTGTTGAAGAA
CGGGCGCGAGCCCGAGAGCGCGAGCGAGTTCAGCACGCGGATTCAGGAGTTTCTGTCGGATTTCGAGCGC
GGCGCGAAGAAGCTCAATATCGCGGCCGAAGATGTGTACGGCGCGAAGTTCGCGTACTGCGCGGCCGTCG
ACGAGATGGTGCTGTCGTCGCAGTTCAAGATTCGCGCGGACTGGGAGCGCCGGCCGCTGCAGCTCGTGCT
GTTCGGCGAGCAGCTGGCGGGCGAGAAGTTCTTCCAGTATCTCGAGGAGTGCCGTGCGCAAGGCGCGGCG
CGGCTCCAGTCGCTCGAGGTGTTTCATATGTGCCTGCTGCTCGGATTCCAGGGCAAGTATCTGCTCGAAG
GGCCGGAGAAGCTGGCTTATCTGACCGCGCGGCTGGGCGACGAGATCGCGCATATGAAAGGCAAGCGTGC
GCCGTTCGCGCCGCATTGGCCGCTGCCGGATCGGATCGCGCATCGGCTCAAGCGCGAAGTGCCGGTGTGG
GCGATCGGGGCGGTGTTCGCGCTCGTCGCGCTGCTCGGGTATCTCGGGCTCAATGCGTATCTCAAGGGCA
AGACGCTGCAGGCGTTGGCGCCTTATTCGCAGGTGATCAAGGTCGGGCCGGAGTCGGCGAATTTGACGAT
TTCGTTGCCTTGA