SecReT6
Protein ID: 162418124
SecReT6 ID247
T6SS typei2
Gene symbol-
Locus tagYpAngola_A2994
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3162440..3163525 [+]
Producthypothetical protein
NoteTssG
UniProt IDA9R192
KEGG IDypg:YpAngola_A2994
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.70E-81, Aligned region: 19..319
Protein Sequence: 361 a.a.     [Download]
>gi|162418124|ref|YP_001607363.1| hypothetical protein YpAngola_A2994 [Yersinia pestis Angola]
MGRESSVPPSRLITRLKRDIGQINFYRFCQLLEQQPGTLPLGSTNSPADDPVRFRPHPGMGFPVSELKAL
ENDPLHPEAPLTARTTFMGLYGVDSPLPTAYIDDITQQREGHEALEGFLDIFNHRFMTQFYRIWRKYSYP
ATFESGGTDNTSQSLLGLIGMGIPGSQQHFATPTSRFLALLGVMRQPGRTAEGVQALVRLLAPFTEADVT
PHCLRTVRLTSPMAFADEGANWLDGYTVLGDEAIDANSQLLISLRTADRDEAANWLPDGPLYTDFLVLLR
VYLGWRYRACIQLTVATRLLPALVLDETPIRLGLTGVLGLDDATLSDDIPEYFTVALGHYRGLAPQQHQE
GNRRVNYRLEK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3162440-3163525 Yersinia pestis Angola chromosome, complete genome
ATGGGAAGAGAATCATCAGTCCCGCCTTCCCGGCTAATCACCCGGCTTAAGCGCGATATCGGCCAGATCA
ATTTTTACCGTTTCTGTCAGTTGCTGGAGCAACAACCGGGAACCTTGCCGCTCGGCAGTACCAACAGCCC
GGCGGATGATCCGGTGCGTTTTCGTCCGCATCCCGGCATGGGTTTTCCGGTCAGTGAACTGAAGGCGCTG
GAAAACGACCCGCTGCATCCGGAAGCCCCGTTGACCGCGCGCACCACCTTTATGGGGTTGTACGGGGTGG
ATTCGCCTTTGCCGACGGCCTATATCGACGATATCACCCAGCAGCGCGAAGGGCATGAGGCGCTGGAAGG
GTTCCTCGATATTTTCAACCACCGTTTTATGACGCAGTTTTATCGCATCTGGCGCAAATATTCCTATCCG
GCCACTTTTGAGTCGGGCGGCACAGACAATACCTCTCAGAGCCTGTTGGGGCTGATAGGCATGGGTATTC
CTGGCTCACAGCAGCATTTTGCCACCCCGACATCGCGCTTTCTGGCCTTGCTGGGGGTGATGCGACAACC
GGGGCGCACTGCCGAAGGGGTACAGGCGCTGGTCCGGCTGCTGGCCCCGTTTACCGAGGCGGATGTCACG
CCCCATTGCCTGCGCACGGTGCGCCTGACTTCTCCGATGGCGTTTGCCGATGAAGGGGCCAACTGGCTGG
ACGGCTACACCGTGCTGGGTGATGAGGCCATTGATGCCAACAGTCAGTTGCTGATTTCGCTGCGCACGGC
AGACCGCGACGAGGCCGCTAACTGGTTACCGGATGGCCCGCTGTATACCGATTTTCTGGTGCTGTTGCGG
GTCTATCTGGGCTGGCGTTACCGGGCCTGTATCCAACTGACGGTCGCCACCCGGTTGCTGCCGGCGTTGG
TGTTGGATGAGACACCGATAAGGCTGGGATTAACCGGCGTGCTGGGGCTGGATGACGCGACGCTGTCAGA
CGATATACCTGAATATTTTACCGTGGCGCTGGGCCACTACCGTGGGCTGGCTCCACAGCAACATCAAGAA
GGAAACCGACGTGTTAACTACCGTTTGGAAAAATAA