SecReT6
Protein ID: 162418269
SecReT6 ID247
T6SS typei2
Gene symbol-
Locus tagYpAngola_A2990
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3157345..3158946 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA9R188
KEGG IDypg:YpAngola_A2990
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 69..126
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 157..182
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 302..315
ImpA-rel_N [PF06812], Evalue: 1.40E-20, Aligned region: 354..364
Protein Sequence: 533 a.a.     [Download]
>gi|162418269|ref|YP_001607359.1| ImpA domain-containing protein [Yersinia pestis Angola]
MATLTTLLTACAAEPEPLLQQARQQVALWERWLQPVTPDKHTGEDPGYDDHFQQMREEVNKLSGADTTLT
CELAEKLFTTHGKDVRVATYYVWARLHRDGEAGLADGLSLLAGLITRFGEGLHPLRTTSRKTALEWLAGS
RMRDSLSLYPEVDKADFERIVGALALIEQRLSLWDEGVRPQLGGLYTALENRLAQSGGLNAVVPQNSSGS
SSAGSLNPANTASPALRPVQSGRDLLDQTKTLAKYLRNQPQGWLSGHHLIKSVRWDTVHQSPPLDVNGRT
RLVPPRPEYRVQLKRLYLQQNWLALLEQAESIFAEGVNHFWLDVQWYLHQALSKAGAPFDGWASCITQDL
RLLLTRLPGLEGLCWSDGTPFADEVTLGWINQQVLESVSGWGSEPAAVSSGEDGILLLEPEALAQADSEG
IEAALNWLQSRPGITTARHQWLLRLVMARVAEQYGKNDMALHLLSGLDSSGALLTLPQWEPGLVFEVKAR
RLKLLRMKAQRGDSDKTRLHAEMESLLSGLIALDPARAAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3157345-3158946 Yersinia pestis Angola chromosome, complete genome
ATGGCGACGTTAACTACCTTGCTCACCGCTTGTGCCGCAGAGCCTGAGCCACTTTTACAGCAGGCCAGAC
AACAGGTTGCGCTCTGGGAACGTTGGTTGCAACCGGTGACACCCGATAAGCATACCGGTGAAGACCCCGG
TTACGATGACCACTTCCAACAGATGCGTGAAGAGGTCAATAAGCTCTCGGGTGCCGATACCACGCTGACC
TGCGAGCTGGCTGAAAAGCTGTTCACCACACACGGCAAGGATGTGCGGGTGGCAACCTATTACGTCTGGG
CGCGGTTGCACCGTGACGGCGAGGCCGGGCTGGCGGATGGCCTTTCCCTGCTGGCCGGGCTGATCACGCG
CTTTGGTGAGGGCCTGCATCCGCTGCGTACAACCAGCCGGAAAACCGCGTTGGAGTGGCTGGCCGGCTCC
CGGATGCGCGACAGCTTGTCACTTTACCCGGAAGTGGATAAAGCCGATTTTGAGCGTATCGTGGGCGCAC
TGGCCCTTATCGAACAGAGGCTCAGTCTCTGGGACGAAGGCGTCCGGCCGCAACTGGGCGGGTTGTATAC
CGCCCTGGAAAACCGCCTCGCGCAATCTGGTGGGCTAAATGCCGTGGTGCCGCAAAACAGCAGCGGGTCA
TCATCGGCAGGCAGCTTGAACCCAGCCAACACGGCGTCACCGGCGTTGCGGCCAGTGCAATCGGGACGTG
ACCTGCTCGATCAGACCAAAACGCTGGCAAAATACCTGCGCAACCAGCCGCAGGGCTGGCTCTCCGGGCA
TCATCTTATCAAAAGCGTGCGCTGGGATACGGTACATCAGTCACCGCCATTAGATGTGAACGGACGGACC
CGGCTGGTACCGCCGCGCCCGGAATATCGCGTACAACTCAAGCGCCTTTATCTGCAACAAAACTGGCTGG
CGTTGCTGGAACAGGCCGAATCGATATTTGCCGAAGGGGTTAACCATTTCTGGCTCGATGTGCAGTGGTA
TCTGCATCAGGCCCTCAGCAAAGCGGGGGCCCCATTCGATGGCTGGGCGAGCTGTATCACGCAGGATTTA
CGGTTATTACTGACCCGGCTGCCGGGGCTGGAAGGGCTATGCTGGAGTGACGGCACGCCATTTGCCGATG
AGGTGACGCTGGGGTGGATAAACCAGCAGGTACTGGAGTCGGTCTCGGGCTGGGGCAGCGAGCCGGCCGC
CGTTTCATCCGGTGAGGATGGCATTCTGTTGCTGGAGCCAGAAGCTTTGGCTCAGGCGGACAGCGAAGGA
ATTGAAGCGGCGCTTAACTGGTTGCAGTCACGACCGGGGATCACCACGGCGCGCCATCAGTGGCTGCTGC
GTCTGGTGATGGCCCGGGTGGCGGAGCAGTACGGTAAGAACGATATGGCCTTGCATCTGCTGAGTGGCCT
TGATAGCAGCGGCGCGTTGTTGACCTTGCCACAGTGGGAGCCGGGGTTGGTGTTTGAAGTTAAAGCCCGC
CGTTTGAAGCTGTTGCGTATGAAGGCACAGCGGGGTGACAGTGATAAAACCCGCCTGCATGCTGAAATGG
AAAGCCTGCTCAGTGGGCTTATCGCCCTCGACCCGGCCCGTGCGGCCGTATTATGCGGATAA

Protein ID: 162418939
SecReT6 ID247
T6SS typei2
Gene symbol-
Locus tagYpAngola_A2997
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3164558..3165925 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA9R195
KEGG IDypg:YpAngola_A2997
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.20E-50, Aligned region: 92..150
DUF3702 [PF12486], Evalue: 3.20E-50, Aligned region: 303..448
ImpA-rel_N [PF06812], Evalue: 7.80E-20, Aligned region: 40..100
ImpA-rel_N [PF06812], Evalue: 7.80E-20, Aligned region: 231..244
Protein Sequence: 455 a.a.     [Download]
>gi|162418939|ref|YP_001607366.1| ImpA domain-containing protein [Yersinia pestis Angola]
MAGNTERLLKTGGDPRALADFTALRGELNKLAHPARPDVDWVRVEQLCLALFRQNGVELQTAVDFTLART
HTVGLAGLCEGLELLAGLVCHQWRGLWPPQTHARVALLAWLNDRLQQVWRTMTLCYGDLAQVYRAERALE
QLCTQLQTLELKHLCKLDGVRLMLHNAAQRLESTEAVSGLAKPRGASEPPESLRFASVPVSEPLVYIISE
PAPPPVQVVLPASPPRWKAGHGFAAGLSLMAVLMAGSFVIWQSVSSDPVRETLLATASPLPIPLSANSIA
ELKKQASDVEWARLAEPVLQASAMQLDQLTQLPPLWAQARGDALLSQAQQLWPTNQEVKRLNALWQQQRA
AGAAPLVELKHYALAQDRLRQLAERLNSLDEKKRGYMTVSELKSAVFAIQQPLAQAVPLEELLRQYQEQL
ESGQTPSSALRQQIDSRFSQLLNRYALLVVPPGVQ
 
Nucleotide Sequence: 1368 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3164558-3165925 Yersinia pestis Angola chromosome, complete genome
ATGGCAGGTAATACCGAGCGTCTGCTGAAAACCGGTGGCGATCCGCGCGCACTGGCGGATTTCACCGCAC
TGCGGGGTGAATTAAATAAACTGGCCCACCCGGCCCGCCCGGATGTTGATTGGGTGCGAGTCGAGCAGCT
TTGTTTGGCGCTGTTTCGCCAGAACGGCGTTGAGTTACAGACTGCCGTTGATTTTACCCTGGCACGAACG
CACACCGTTGGGTTGGCGGGCTTATGTGAAGGGCTGGAACTGTTGGCGGGGTTGGTCTGCCATCAATGGC
GTGGGTTATGGCCACCGCAAACGCATGCCCGGGTGGCGTTACTGGCCTGGTTGAACGACCGGCTGCAGCA
AGTGTGGCGCACCATGACGCTGTGCTACGGTGACCTGGCGCAGGTGTACCGGGCAGAGCGGGCGCTGGAA
CAGTTGTGTACGCAGTTGCAAACGCTGGAGCTCAAACATTTGTGCAAGCTGGACGGGGTTCGTTTGATGC
TGCATAACGCGGCGCAGCGGTTGGAAAGTACCGAGGCCGTGTCTGGCCTTGCGAAACCACGGGGTGCCTC
TGAACCGCCCGAGTCGCTGCGATTTGCCTCTGTCCCGGTCAGTGAACCACTGGTGTATATTATCAGCGAA
CCGGCCCCGCCACCTGTTCAGGTGGTTTTACCTGCCTCACCTCCGCGCTGGAAGGCGGGCCACGGTTTTG
CCGCGGGGTTATCGTTGATGGCGGTACTGATGGCCGGCAGTTTCGTTATCTGGCAGTCGGTATCATCGGA
TCCCGTGAGGGAAACATTGCTGGCCACTGCCAGTCCTTTGCCGATACCGCTGAGTGCTAACTCAATAGCT
GAACTGAAAAAACAGGCTTCAGATGTTGAGTGGGCACGTCTGGCGGAACCGGTGTTGCAAGCCAGTGCGA
TGCAGTTAGATCAACTAACACAGTTACCGCCGTTATGGGCGCAGGCTCGGGGGGATGCCTTGCTATCTCA
GGCGCAACAACTGTGGCCGACCAATCAAGAGGTCAAACGACTGAATGCGTTGTGGCAGCAACAGCGAGCA
GCCGGTGCTGCGCCCTTGGTAGAGTTGAAACACTATGCATTGGCGCAAGACCGTTTGCGGCAACTGGCAG
AACGACTGAATAGTCTGGATGAGAAAAAACGCGGATATATGACGGTCTCCGAACTGAAATCTGCCGTTTT
TGCTATCCAACAGCCGCTGGCACAGGCCGTGCCACTGGAAGAACTGCTGCGGCAATATCAGGAACAATTA
GAATCAGGGCAAACTCCATCCTCAGCACTGCGTCAACAGATTGACAGCCGGTTTAGTCAATTGCTGAACC
GCTATGCGTTGCTGGTCGTACCTCCTGGCGTTCAGTAA