SecReT6
Protein ID: 162418406
SecReT6 ID245
T6SS typeN/A
Gene symbol-
Locus tagYpAngola_A2699
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]2826995..2828176 [+]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA9QZD1
KEGG IDypg:YpAngola_A2699
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.60E-18, Aligned region: 62..121
ImpA-rel_N [PF06812], Evalue: 3.60E-18, Aligned region: 203..215
Protein Sequence: 393 a.a.     [Download]
>gi|162418406|ref|YP_001607099.1| ImpA domain-containing protein [Yersinia pestis Angola]
MSEQSIAERAGYYQSMMQPIPGDFPCGKNLEYDPAFIMLQTKLQPKQAAEYGNFVEVAEPNNWTDIERKC
LELLNNSRDIRLFIILMRCRMRQVGVGALQEGLEAILWCLDTWPDQLHPQLFDEGEFEPLMRGNAFAELE
DIDGFIADFRNQQLPKAAGVQLSIKEFEKAHSVPREEGALDEGTLEAVKQEWQNRSDHTILSLQHAYALL
QGLATRLNNSLGEDTPDFVRMTSVLRHFDAAITPIAPIVVPIPEVVELYPVATAMLASTEMPVTAEVQTV
AETQMAIPIEAPQQRQAVVTPSPQLQPLQLQSAQLQPVPIQSQPVPVQQQGIQNRADALARLIEVREWFT
AMEPSSPVIALLAFSEKTIGKSFGELLQFIPQELISKLNEGQE
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|162418099|ref|NC_010159.1|:2826995-2828176 Yersinia pestis Angola chromosome, complete genome
ATGAGTGAACAGAGTATCGCTGAACGTGCCGGTTATTATCAAAGCATGATGCAGCCCATTCCAGGTGACT
TTCCTTGTGGCAAAAATCTGGAATATGACCCGGCATTTATTATGCTACAGACAAAATTGCAACCTAAGCA
GGCCGCTGAATACGGCAATTTTGTTGAGGTCGCTGAACCCAATAACTGGACAGATATCGAGCGTAAATGC
CTTGAACTCCTGAATAATTCTCGGGATATTCGGCTGTTTATTATTCTGATGCGCTGCCGGATGCGTCAGG
TCGGTGTGGGCGCGTTGCAAGAAGGGCTGGAAGCCATACTTTGGTGCCTCGACACTTGGCCTGATCAGCT
ACATCCTCAGTTGTTTGATGAAGGGGAATTTGAACCTTTAATGCGCGGTAATGCTTTTGCTGAACTGGAA
GATATTGATGGTTTTATCGCCGACTTCCGTAATCAGCAGTTACCCAAAGCCGCTGGCGTGCAACTTTCCA
TCAAAGAGTTTGAAAAAGCACACTCCGTTCCTCGAGAAGAAGGGGCATTGGACGAAGGGACTCTGGAAGC
CGTTAAGCAAGAGTGGCAGAACCGATCAGATCACACCATTCTCTCACTCCAGCACGCTTATGCCTTGTTG
CAAGGATTAGCCACGCGCCTCAACAACTCCCTCGGTGAAGACACACCTGATTTTGTCAGAATGACCTCAG
TGTTACGCCACTTTGATGCCGCGATAACCCCGATAGCGCCTATCGTGGTGCCGATCCCAGAAGTTGTCGA
GCTCTATCCAGTCGCCACAGCGATGCTAGCAAGCACAGAAATGCCAGTGACCGCCGAGGTACAGACGGTT
GCAGAGACACAAATGGCCATACCCATTGAAGCTCCCCAACAGCGTCAAGCGGTGGTAACCCCATCCCCAC
AGTTGCAGCCGTTACAGTTGCAATCGGCACAGTTGCAACCTGTACCGATACAGTCACAGCCGGTGCCTGT
CCAGCAGCAAGGGATCCAAAACAGGGCTGATGCATTAGCCCGGCTTATAGAGGTGCGAGAGTGGTTTACC
GCCATGGAACCGAGTAGCCCGGTCATTGCCTTACTGGCTTTTTCAGAAAAAACTATCGGCAAAAGCTTCG
GCGAATTGCTGCAGTTCATTCCTCAGGAACTGATTTCGAAACTCAATGAAGGACAGGAGTAA