SecReT6
Protein ID: 162418687
SecReT6 ID244
T6SS typeN/A
Gene symbol-
Locus tagYpAngola_A1933
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]2002910..2003170 [-]
Producthypothetical protein
NotePAAR
UniProt IDA9R768
KEGG IDypg:YpAngola_A1933
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 6..78
PAAR_motif [PF05488], Evalue: 1.30E-15, Aligned region: 73..86
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 16..36
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 38..70
DUF4150 [PF13665], Evalue: 0.0011, Aligned region: 75..85
Protein Sequence: 86 a.a.     [Download]
>gi|162418687|ref|YP_001606407.1| hypothetical protein YpAngola_A1933 [Yersinia pestis Angola]
MFSAAKMGDVTSDGGAICTGSCDVFINNIPASKLGSGATSTLVGLTALVTGSGTVFINNCPATRCSDKTG
CGSVIVTGSPNVFIGN
 
Nucleotide Sequence: 261 bp     [Download]
>gi|162418099|ref|NC_010159.1|:c2003170-2002910 Yersinia pestis Angola chromosome, complete genome
ATGTTCAGTGCGGCAAAAATGGGCGATGTGACCAGCGATGGTGGTGCGATATGTACCGGTTCATGCGATG
TGTTCATTAACAATATTCCGGCCTCTAAGCTGGGTTCGGGCGCAACGTCTACGTTGGTAGGCCTGACGGC
GCTGGTAACTGGCTCTGGAACGGTATTTATCAATAATTGTCCCGCGACGCGTTGTAGTGATAAGACGGGG
TGTGGCTCGGTTATTGTCACTGGGTCGCCCAATGTATTTATAGGTAACTAA