SecReT6
Protein ID: 162418765
SecReT6 ID247
T6SS typei2
Gene symbol-
Locus tagYpAngola_A2991
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3158964..3160022 [+]
ProductPAAR domain-containing protein
NotePAAR
UniProt IDA9R189
KEGG IDypg:YpAngola_A2991
PDB IDNA
Domain hit(s) vs Pfam Toxin_60 [PF15607], Evalue: 6.20E-28, Aligned region: 194..303
PAAR_motif [PF05488], Evalue: 3.50E-10, Aligned region: 10..65
Protein Sequence: 352 a.a.     [Download]
>gi|162418765|ref|YP_001607360.1| PAAR domain-containing protein [Yersinia pestis Angola]
MAKGYYLGVGDETTCGGVIIEGDATHVLMGKAVAREQDRVTCGKHPGTYIIIGHVPGDSVNGRKFAGTLN
SQSNCPCKAWFIPSLVHDTYEFGARSKSQNMSEISTEVEREMVENVSESEEKSKVVCAHIDGALVVASYI
LDEIKKNVKSDTADKIRSFIDNDLYKKRLKEWQDSPWYARMNAPPQPEIISASVLWFMAVKSGAKWDHKP
KIRDQFKAYAVSRPLVGSGTRSKSYFHKYEEHDYFYDVWSNIHYGYVGLSLGFDESYLLLGSTLEQVRTS
IGSKPDPIDDITCMKIGYALYHQHGKYAETLDVRHILDALESASDLDLAISRQIHWCWNNDNSSQIDHPQ
GK
 
Nucleotide Sequence: 1059 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3158964-3160022 Yersinia pestis Angola chromosome, complete genome
ATGGCAAAAGGCTATTACCTTGGGGTTGGGGATGAAACAACCTGCGGCGGCGTGATCATCGAAGGTGACG
CCACACATGTCTTGATGGGTAAAGCGGTGGCCCGTGAACAAGACAGAGTGACCTGCGGTAAACATCCGGG
AACCTATATTATTATCGGCCATGTTCCTGGCGATTCGGTAAATGGCCGCAAGTTTGCGGGCACCTTGAAT
AGTCAAAGCAATTGCCCGTGCAAGGCGTGGTTTATTCCTTCTTTGGTGCATGATACGTATGAGTTTGGTG
CAAGAAGTAAATCACAAAATATGTCTGAAATTAGTACTGAAGTCGAACGTGAGATGGTAGAAAATGTGAG
TGAATCAGAAGAAAAATCTAAAGTTGTCTGTGCCCATATTGATGGCGCTTTAGTAGTAGCGAGTTATATC
CTTGATGAAATAAAGAAAAATGTAAAAAGTGATACCGCTGATAAAATCAGATCTTTTATCGATAATGACC
TCTATAAAAAAAGACTTAAGGAGTGGCAGGATTCTCCTTGGTACGCGAGAATGAATGCACCTCCACAGCC
TGAAATAATATCGGCATCGGTTTTATGGTTTATGGCGGTCAAGAGTGGTGCTAAATGGGATCATAAACCT
AAAATTAGAGATCAATTTAAAGCATATGCAGTTTCTCGTCCTCTGGTCGGAAGCGGAACCCGATCAAAAA
GCTATTTTCATAAATATGAAGAACATGATTATTTTTATGATGTCTGGTCCAATATTCACTATGGTTATGT
AGGCTTAAGTCTTGGTTTTGATGAGTCATATTTATTACTTGGCTCAACTCTTGAGCAAGTAAGAACCAGC
ATCGGGAGTAAACCAGATCCTATAGATGATATTACATGTATGAAAATTGGCTATGCACTCTATCATCAAC
ATGGAAAATATGCTGAGACGTTAGATGTCAGGCATATACTCGATGCTCTTGAATCAGCATCGGACCTTGA
TCTAGCTATTTCAAGACAAATTCATTGGTGTTGGAATAATGATAATTCGAGTCAAATTGATCACCCGCAG
GGTAAGTAA