SecReT6
Protein ID: 162419255
SecReT6 ID243
T6SS typei3
Gene symbol-
Locus tagYpAngola_A0758
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]772770..773753 [-]
Producthypothetical protein
NoteTssG
UniProt IDA9QZX6
KEGG IDypg:YpAngola_A0758
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 3.00E-66, Aligned region: 18..312
Protein Sequence: 327 a.a.     [Download]
>gi|162419255|ref|YP_001605333.1| hypothetical protein YpAngola_A0758 [Yersinia pestis Angola]
MASLQTLKNTFLPGISASQDFFELLRRIERATPEQGRLGTQRDRSHLRLRIIQPADMGFAPREVSDIRQT
LNTHQHLAEITIFCRHFGLFAPYGPLPIHVTEHARNEALAKRNQAFEHFAGILSQRMAILHYRSWAQMHV
AVGHDRASANPFMNHVRQIAGLTPQQALNSHVDRVRRCFPGVYLPGRGSLRKLQEILSLYFSVPIRVEAR
KGLWIDDSRNIESQRMGRLGNTRIGSRFFDVQHSLVLSIGPVSDPQYLDFQRNSKRINTLVQICHDFVRH
RMVLDVQLIIQTSPNMACRLGGGTLSRHSWLKPGSALSIQPIYRTVT
 
Nucleotide Sequence: 984 bp     [Download]
>gi|162418099|ref|NC_010159.1|:c773753-772770 Yersinia pestis Angola chromosome, complete genome
ATGGCTAGCCTCCAGACGCTGAAAAACACGTTTCTGCCGGGTATCTCGGCCAGTCAGGACTTTTTCGAGT
TGCTGCGTCGCATTGAGCGTGCCACTCCAGAGCAAGGCCGGCTTGGCACCCAACGTGATCGTAGCCATCT
GCGGCTACGTATTATTCAGCCTGCCGATATGGGATTTGCACCGCGTGAAGTGAGTGATATCAGGCAAACG
CTGAACACTCATCAGCATCTGGCAGAGATCACCATTTTCTGCCGCCATTTTGGTTTATTTGCCCCGTATG
GCCCGTTGCCAATACATGTTACCGAACATGCTCGTAACGAAGCGTTGGCTAAACGTAATCAGGCCTTTGA
ACATTTTGCGGGCATTCTCAGCCAGCGAATGGCGATCTTGCATTATCGCTCTTGGGCCCAAATGCACGTC
GCCGTGGGGCATGATCGCGCGTCAGCCAATCCCTTTATGAACCATGTGCGTCAAATCGCGGGCCTAACGC
CGCAGCAAGCGCTGAATTCACATGTGGATCGGGTACGGCGTTGCTTTCCGGGGGTGTATCTGCCGGGCAG
AGGATCATTACGCAAATTACAGGAGATCCTGAGCCTGTATTTCTCGGTTCCTATCCGTGTTGAAGCCCGT
AAAGGATTGTGGATTGACGACTCGCGCAATATAGAAAGCCAACGTATGGGACGGTTGGGTAACACGCGTA
TTGGCAGCCGTTTCTTCGATGTGCAGCACAGCCTGGTGTTATCTATTGGTCCGGTATCTGACCCCCAATA
TCTGGATTTTCAACGCAACAGCAAACGCATTAACACTCTGGTGCAAATCTGCCATGACTTTGTCCGCCAT
CGGATGGTGCTGGACGTGCAATTAATCATACAGACCTCACCCAATATGGCTTGTCGTCTTGGCGGTGGAA
CGCTCAGTCGCCATAGCTGGTTAAAGCCAGGCTCAGCCTTGAGTATACAGCCAATTTATAGAACGGTTAC
CTAG