SecReT6
Protein ID: 162419365
SecReT6 ID245
T6SS typeN/A
Gene symbolclpV
Locus tagYpAngola_A2696
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]2820533..2823208 [-]
ProductClp ATPase
NoteTssH
UniProt IDA9R0H2
KEGG IDypg:YpAngola_A2696
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 231..310
AAA_2 [PF07724], Evalue: 1.90E-39, Aligned region: 619..785
AAA [PF00004], Evalue: 1.00E-20, Aligned region: 233..364
AAA [PF00004], Evalue: 1.00E-20, Aligned region: 624..741
ClpB_D2-small [PF10431], Evalue: 1.80E-16, Aligned region: 791..869
AAA_5 [PF07728], Evalue: 4.20E-13, Aligned region: 233..311
AAA_5 [PF07728], Evalue: 4.20E-13, Aligned region: 623..741
AAA_16 [PF13191], Evalue: 2.30E-08, Aligned region: 211..249
AAA_16 [PF13191], Evalue: 2.30E-08, Aligned region: 271..311
AAA_16 [PF13191], Evalue: 2.30E-08, Aligned region: 498..517
AAA_16 [PF13191], Evalue: 2.30E-08, Aligned region: 621..659
AAA_16 [PF13191], Evalue: 2.30E-08, Aligned region: 688..711
AAA_16 [PF13191], Evalue: 2.30E-08, Aligned region: 787..811
Sigma54_activat [PF00158], Evalue: 2.90E-07, Aligned region: 228..252
Sigma54_activat [PF00158], Evalue: 2.90E-07, Aligned region: 623..722
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 233..319
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 366..399
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 621..643
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 685..710
AAA_14 [PF13173], Evalue: 3.20E-06, Aligned region: 233..313
AAA_14 [PF13173], Evalue: 3.20E-06, Aligned region: 622..705
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 227..255
IstB_IS21 [PF01695], Evalue: 3.10E-05, Aligned region: 623..643
AAA_29 [PF13555], Evalue: 3.10E-05, Aligned region: 223..256
AAA_29 [PF13555], Evalue: 3.10E-05, Aligned region: 621..648
AAA_19 [PF13245], Evalue: 3.80E-05, Aligned region: 231..255
AAA_19 [PF13245], Evalue: 3.80E-05, Aligned region: 621..645
AAA_25 [PF13481], Evalue: 5.00E-05, Aligned region: 233..257
AAA_25 [PF13481], Evalue: 5.00E-05, Aligned region: 287..322
AAA_25 [PF13481], Evalue: 5.00E-05, Aligned region: 621..648
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 25..74
Clp_N [PF02861], Evalue: 6.10E-05, Aligned region: 112..122
Zeta_toxin [PF06414], Evalue: 6.30E-05, Aligned region: 233..248
Zeta_toxin [PF06414], Evalue: 6.30E-05, Aligned region: 616..663
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 212..246
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 286..383
Arch_ATPase [PF01637], Evalue: 0.00013, Aligned region: 622..668
AAA_17 [PF13207], Evalue: 0.00044, Aligned region: 63..109
AAA_17 [PF13207], Evalue: 0.00044, Aligned region: 234..252
AAA_17 [PF13207], Evalue: 0.00044, Aligned region: 377..406
AAA_17 [PF13207], Evalue: 0.00044, Aligned region: 623..658
NACHT [PF05729], Evalue: 0.00072, Aligned region: 233..262
NACHT [PF05729], Evalue: 0.00072, Aligned region: 623..650
AAA_18 [PF13238], Evalue: 0.003, Aligned region: 233..252
AAA_18 [PF13238], Evalue: 0.003, Aligned region: 625..649
AAA_23 [PF13476], Evalue: 0.0062, Aligned region: 233..253
AAA_23 [PF13476], Evalue: 0.0062, Aligned region: 469..542
AAA_23 [PF13476], Evalue: 0.0062, Aligned region: 621..646
UPF0079 [PF02367], Evalue: 0.0098, Aligned region: 233..253
UPF0079 [PF02367], Evalue: 0.0098, Aligned region: 621..650
Protein Sequence: 891 a.a.     [Download]
>gi|162419365|ref|YP_001607096.1| Clp ATPase [Yersinia pestis Angola]
MAITRKHLFGKLDATLFKGIESATTICKLRGNPYVELVHWLNQLWHQEDNDLKQIIRYFAVDVDAFEREL
AQALAKLPVGATSISDFSYHIELATERAWIYASLECLDTRIRSGHLLLALLTTMELRRAFFAIAPSMEKI
PLEHLSKDLNFITQASPEANEAASDGSPLYDGALPGEASNAIGAAKSGGALAQYTTDLTALAREGKIDPV
LGRNHEINTMVDILLRRRQNNPLLTGDAGVGKTAIVEGLALAIVAGSMPPALSQVSLLSLDIVALSAGAS
MKGEFEARLKSVLDEAIAAEKPVILFIDEVHTLIGAGCNAGTGDAANLLKPALARGQLRTIGATTWSEFK
RHIEKDPALTRRFQVLQVDEPDENTAISMLRGLIPALEKHHGVWIMDEALQAAVRLSHRYIPARQLPDKA
ISLLDTACARIAVAQFSQPIELQHLTFQSETAQTELVSLEKARHFGKAQDARTEQLKTSIAEHGEAADKL
DQRWQAERELVSAITTIRTALYDLVSQPEPDEEKRRAYQAQLVQLEAQLSQVRTSLPLVQTEVNAEVIAS
IVADWTGIPVGQMLKDDIRAVMELPQRLEARVIGQPHALMQLGENIMTARAGLSDPRKPLGVFMLVGPSG
VGKTETALAIAESMYGGEQNMITINMSEYQESHTVSSLKGSPPGYVGYGEGGVLTEAVRRKPYSVVLLDE
IEKAHSDVHELFFQVFDKGQMEDGEGRFIDFKNTILLLTSNVGSELLSNLLADPDTAPDQDGILSALQPE
LLKVFPAAFLGRVTVIPYLPLQQDALQHIVRLHLDRIGARLYSQHQLTLKYSDEVVEDVVSRCAVSETGA
RMLIRYIEQNITPKIGKYILGDSDVKPEQIIFVHKNENGFVIALQCKDDEN
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|162418099|ref|NC_010159.1|:c2823208-2820533 Yersinia pestis Angola chromosome, complete genome
GTGGCTATTACAAGGAAACATCTCTTCGGCAAGCTGGACGCCACTCTTTTCAAAGGTATTGAAAGCGCAA
CAACGATTTGTAAATTACGCGGCAATCCTTACGTAGAGTTAGTTCACTGGTTGAATCAGCTTTGGCATCA
GGAAGATAACGACCTTAAGCAGATTATTCGGTATTTTGCGGTGGATGTGGATGCCTTTGAGCGTGAACTG
GCTCAGGCACTTGCGAAGTTACCTGTTGGGGCAACTAGCATTTCAGATTTTTCGTATCATATTGAGTTGG
CCACGGAACGGGCTTGGATCTATGCCAGCCTGGAGTGTTTAGATACCCGTATCCGCAGCGGACATCTGCT
GCTTGCGCTATTAACCACAATGGAACTGCGGAGAGCTTTCTTTGCGATTGCGCCAAGCATGGAAAAAATT
CCATTAGAGCATTTAAGCAAAGATTTGAACTTCATTACGCAGGCATCACCAGAAGCGAATGAAGCCGCCA
GTGATGGCAGCCCGTTGTACGATGGTGCTTTACCTGGCGAAGCCAGTAATGCCATTGGTGCAGCCAAAAG
TGGTGGCGCACTGGCTCAATACACCACAGACCTCACGGCATTAGCACGTGAAGGCAAGATAGATCCGGTA
TTGGGACGTAATCACGAAATCAACACAATGGTTGATATTCTCTTGCGCCGTCGGCAGAACAACCCATTAC
TTACCGGTGACGCAGGGGTGGGTAAAACCGCCATTGTTGAAGGGCTAGCATTGGCTATTGTTGCTGGCTC
AATGCCACCAGCATTAAGCCAGGTAAGCCTGTTGTCATTAGATATTGTGGCGCTCTCAGCGGGTGCCAGC
ATGAAAGGTGAATTTGAAGCGCGCCTGAAGAGTGTCTTGGATGAAGCGATAGCGGCAGAAAAGCCCGTTA
TTTTGTTTATCGATGAAGTACACACACTTATTGGCGCGGGTTGCAATGCCGGGACCGGCGATGCGGCGAA
CTTATTGAAACCTGCATTGGCGCGTGGCCAGTTACGTACCATTGGTGCGACAACGTGGAGCGAGTTCAAG
CGTCACATTGAGAAGGATCCGGCACTCACCCGTCGTTTCCAAGTACTTCAAGTTGATGAGCCCGATGAGA
ACACGGCGATCTCCATGTTACGGGGCCTGATACCTGCGCTAGAAAAGCACCACGGCGTGTGGATTATGGA
CGAAGCTTTACAGGCGGCAGTACGGTTGTCTCATCGTTATATCCCTGCGCGTCAGTTGCCGGATAAAGCG
ATAAGTCTGCTTGATACGGCTTGTGCACGGATCGCTGTCGCGCAGTTTTCACAACCAATAGAGCTACAGC
ACTTAACCTTCCAGAGTGAGACGGCGCAAACTGAGCTGGTTTCCTTAGAGAAAGCGCGGCACTTTGGTAA
AGCGCAGGATGCGCGTACTGAGCAGTTGAAAACATCCATTGCTGAACATGGCGAGGCTGCGGATAAGCTT
GATCAGCGTTGGCAGGCAGAACGCGAATTGGTATCAGCGATTACGACCATAAGAACCGCACTGTATGACT
TGGTTTCTCAGCCAGAGCCTGATGAGGAAAAACGTCGGGCTTATCAAGCGCAATTAGTTCAGTTGGAAGC
GCAGCTTTCTCAGGTTCGCACTTCACTGCCGTTAGTGCAGACAGAAGTCAACGCTGAAGTGATTGCCAGT
ATCGTTGCGGATTGGACCGGCATTCCGGTTGGGCAAATGCTCAAAGACGATATTCGGGCGGTAATGGAGT
TGCCACAGCGCCTTGAAGCACGTGTTATTGGTCAGCCCCATGCATTGATGCAACTGGGTGAAAATATTAT
GACCGCACGCGCTGGCCTGTCAGACCCAAGGAAACCATTGGGGGTCTTTATGTTAGTGGGGCCTTCAGGT
GTGGGTAAAACAGAGACGGCCTTAGCGATCGCCGAGAGCATGTATGGTGGTGAACAGAATATGATCACTA
TCAATATGAGCGAATATCAGGAATCGCATACCGTTTCCTCTTTAAAAGGTTCTCCACCGGGATATGTTGG
ATACGGTGAAGGCGGTGTGTTAACGGAAGCTGTGCGCCGTAAGCCATATAGTGTTGTGTTGTTAGATGAA
ATCGAAAAAGCGCACTCTGATGTACATGAGTTATTCTTCCAAGTGTTTGATAAAGGCCAAATGGAAGATG
GTGAAGGGCGTTTTATCGATTTTAAAAATACTATCTTGTTGTTAACCAGTAATGTGGGCAGCGAGTTACT
GAGTAACTTATTAGCTGATCCAGATACTGCACCGGATCAGGATGGAATATTAAGTGCGTTGCAACCTGAA
TTGCTGAAAGTTTTCCCCGCAGCATTTTTAGGGCGAGTTACGGTTATTCCTTATCTTCCGTTACAGCAAG
ATGCATTGCAGCATATTGTACGGTTGCATTTAGATCGGATTGGCGCTCGTTTATACTCGCAGCATCAATT
GACACTGAAATACAGTGATGAAGTGGTTGAAGATGTTGTTAGCCGCTGTGCGGTCTCAGAGACCGGTGCG
CGTATGCTGATCCGTTACATTGAACAAAATATTACGCCAAAAATAGGTAAATATATTTTAGGTGATAGTG
ATGTGAAGCCTGAGCAAATTATTTTCGTTCATAAAAATGAAAATGGATTCGTGATCGCTTTACAGTGTAA
AGATGACGAAAACTAA