SecReT6
Protein ID: 162419436
SecReT6 ID246
T6SS typei3
Gene symbol-
Locus tagYpAngola_A2876
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3018796..3019401 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDA9R0N9
KEGG IDypg:YpAngola_A2876
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.50E-29, Aligned region: 65..177
Protein Sequence: 201 a.a.     [Download]
>gi|162419436|ref|YP_001607257.1| DotU family type IV/VI secretion system protein [Yersinia pestis Angola]
MDESPQALGRFLLDEPMTSPDSTQDNTAFTREAPHSGAAQQYDTTLLRGESVQQRVAKVLASSTPLLEAA
QPLLRALNEMPAHIGDVSQVHILKQSLKNEITLFSVVCDEADISWKKMAIVRYCLCTALDEAAHTMSWGM
MAGWSQSNLLNHFEGDNDGGNKFFLLVGRLSMSPHEYAVTNGAIVIHTQRLKSDPGGNLLS
 
Nucleotide Sequence: 606 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3018796-3019401 Yersinia pestis Angola chromosome, complete genome
GTGGATGAGAGTCCGCAGGCATTAGGCCGGTTCTTGCTTGATGAGCCAATGACATCCCCAGATAGCACTC
AGGATAATACGGCCTTCACTAGAGAGGCCCCTCATTCTGGTGCGGCACAGCAATATGACACGACCCTCTT
ACGGGGTGAAAGTGTGCAACAGCGTGTCGCTAAAGTACTCGCATCTTCAACGCCATTATTGGAAGCGGCA
CAGCCACTATTACGTGCCTTGAACGAGATGCCCGCGCATATTGGGGATGTTTCACAGGTTCATATATTAA
AACAAAGCCTTAAAAATGAGATCACCCTCTTTAGTGTGGTGTGTGATGAAGCGGATATCTCATGGAAAAA
AATGGCTATCGTCCGCTATTGCCTGTGTACTGCGTTGGATGAAGCCGCTCACACGATGTCGTGGGGAATG
ATGGCAGGTTGGTCACAAAGCAACCTGTTGAACCATTTTGAAGGCGATAATGACGGCGGGAATAAGTTTT
TCTTATTGGTCGGCCGTCTCTCTATGAGCCCGCATGAATATGCTGTAACGAACGGTGCAATAGTGATCCA
CACCCAACGCCTGAAATCAGATCCAGGGGGTAATCTGCTCTCCTGA