SecReT6
Protein ID: 162419574
SecReT6 ID244
T6SS typeN/A
Gene symbol-
Locus tagYpAngola_A1931
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]2001236..2002042 [-]
Producthypothetical protein
NoteTagJ
UniProt IDA9R767
KEGG IDypg:YpAngola_A1931
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 6.00E-45, Aligned region: 145..263
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 47..76
TPR_11 [PF13414], Evalue: 0.0041, Aligned region: 105..136
Protein Sequence: 268 a.a.     [Download]
>gi|162419574|ref|YP_001606406.1| hypothetical protein YpAngola_A1931 [Yersinia pestis Angola]
MNTTNLTELLKSASLTEMLADVIATIKAKPTDTDTRELLFKLYCIDGSWQKALLQLETLTQLLPEFTKQA
ELYKNLILSEKMRDEVLAGKRSPGTLGNDLPEWVALLQQANQLHHDGDHQQSEALREQALQQAPESIGES
AATGCFAWIADSDGRMGPVCEFISAGGYRWIPFAEIQSLTVSKPKNITDLIWAPAQVKVKDKVWYGYIPA
RYPLTPETDNETKLGLKTEWHQPTDSLYIGAGRKMFITDQGEHALFDIEEIVFEIDCV
 
Nucleotide Sequence: 807 bp     [Download]
>gi|162418099|ref|NC_010159.1|:c2002042-2001236 Yersinia pestis Angola chromosome, complete genome
ATGAATACCACGAATTTAACTGAGTTATTAAAAAGCGCGTCTTTAACCGAAATGCTGGCCGATGTCATTG
CTACGATAAAAGCTAAACCAACGGACACCGATACGCGAGAACTGTTATTCAAACTCTATTGTATTGATGG
TTCATGGCAAAAAGCCCTATTGCAGCTTGAAACATTGACACAGCTTTTACCTGAGTTCACCAAACAGGCT
GAACTCTATAAAAATCTGATATTGAGTGAGAAAATGCGTGATGAAGTGCTGGCAGGCAAACGCAGCCCTG
GTACATTGGGTAACGACCTGCCTGAATGGGTAGCCTTGTTGCAACAAGCTAATCAACTCCACCATGATGG
CGATCATCAGCAAAGTGAGGCCCTCCGTGAACAGGCTCTGCAACAGGCACCGGAAAGTATCGGAGAGAGT
GCTGCGACAGGCTGCTTCGCTTGGATTGCTGACAGTGATGGGCGCATGGGGCCTGTTTGTGAGTTTATTA
GCGCCGGCGGTTACCGTTGGATCCCGTTTGCAGAGATACAATCACTCACTGTTTCCAAACCTAAAAATAT
TACAGACCTGATATGGGCGCCGGCACAGGTTAAAGTAAAGGATAAAGTTTGGTACGGTTATATACCTGCC
CGCTATCCACTGACACCTGAAACAGACAATGAAACTAAACTGGGTCTTAAAACAGAATGGCATCAACCGA
CTGACTCACTTTATATTGGGGCAGGGCGGAAAATGTTTATCACCGACCAAGGTGAGCATGCGCTGTTTGA
TATTGAAGAGATTGTATTTGAAATAGATTGTGTTTGA