SecReT6
Protein ID: 162419873
SecReT6 ID245
T6SS typeN/A
Gene symbol-
Locus tagYpAngola_A2697
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]2823991..2825871 [+]
Producthypothetical protein
NoteTssF
UniProt IDA9R0H3
KEGG IDypg:YpAngola_A2697
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-202, Aligned region: 5..625
Protein Sequence: 626 a.a.     [Download]
>gi|162419873|ref|YP_001607097.1| hypothetical protein YpAngola_A2697 [Yersinia pestis Angola]
MDHKFLDYYNKELTFMREMAQEFAEKHPKIAGRLGMHGIEVADPYVERLIESFCFLSARTQIKLDAEFPK
FTQRLLDIVYPNYNSPTPSMGVIQLKPNLKEGDLTQGYCVPRGSSFFTHIAPGETTRCEFRSGQDVELWP
LEIAEARLSSVPPDMPNLEKHRIAYHRLKGALRIKLKLVGDLTFSQLEGLDRLPIYIDGDERIVSHIFEL
LHASHVATIIRAGHGETAKDTVISDQPLSFEGLSPDQSLLPLSWNIFHGHNLVQEYFTCRQRFYFFTLTQ
LSQSLRDNHTGEAEIIILLDRLPQDLVSHVAPSRFLLACTPVINLFPKRMDKIEINRALNDFHVVPDRSR
PLDYEVFAINKVFGQQAETSNEVVFNPLYQTRHCDNGNFGRYFSITRKARTGDSNKRKYDTRTPYASTEV
FVSLVDQQEAPYGDSLRYLSIEAQVTNRDLPRLISASGNFELTMSDSAPVHGARFVFQPSAPRAPFAMDE
SAWRLIRQLSFNYLPLSDMSHSNGGESLRNMLRLFVNASDHESNTQIDALVGCKSEPVIRRLPGNGLLVY
GRGICCTLTVDEEGFSGISPYLFGMIMENYVARHAAINVFTETELNSMQRGRVGHWKARPGRRGVL
 
Nucleotide Sequence: 1881 bp     [Download]
>gi|162418099|ref|NC_010159.1|:2823991-2825871 Yersinia pestis Angola chromosome, complete genome
GTGGATCACAAATTTCTTGACTATTACAATAAAGAACTCACTTTTATGCGCGAGATGGCGCAAGAGTTTG
CTGAAAAACATCCCAAAATAGCAGGCCGCCTGGGCATGCATGGGATTGAAGTCGCCGACCCTTACGTTGA
GCGGCTGATAGAGTCCTTCTGTTTTTTATCTGCCAGAACGCAGATTAAGTTGGATGCTGAGTTTCCTAAA
TTTACTCAGCGTCTTTTGGACATTGTCTATCCTAATTACAATTCGCCAACCCCCTCAATGGGCGTGATCC
AACTTAAGCCAAATCTGAAGGAAGGAGATTTGACTCAAGGGTATTGTGTTCCCAGGGGCAGCTCGTTCTT
CACCCATATCGCACCTGGCGAGACAACCCGCTGCGAGTTCCGCAGTGGTCAGGATGTGGAGTTGTGGCCA
CTGGAAATAGCAGAAGCGCGTCTAAGCTCTGTTCCCCCGGATATGCCTAATCTGGAAAAGCACCGCATTG
CCTATCATCGGCTTAAAGGTGCCTTACGCATTAAATTAAAATTAGTGGGCGATCTCACTTTCTCACAATT
AGAAGGCCTTGATCGGCTGCCTATTTATATTGATGGTGATGAACGAATCGTTTCACATATCTTCGAGCTA
CTCCACGCCAGCCATGTTGCTACCATCATACGGGCAGGCCACGGAGAGACAGCAAAAGACACCGTGATCA
GTGATCAGCCACTGTCCTTTGAAGGGCTAAGCCCCGACCAAAGCCTACTGCCGCTATCATGGAATATCTT
TCACGGACATAATCTGGTGCAGGAATACTTTACCTGCCGCCAGCGTTTCTACTTTTTTACGCTGACACAG
CTGTCGCAAAGTTTGCGCGATAATCATACCGGTGAAGCGGAAATCATCATCCTACTGGACAGATTACCGC
AGGATTTGGTGAGCCATGTTGCCCCCTCTCGCTTCCTGTTAGCCTGCACGCCAGTGATTAATCTCTTTCC
TAAACGCATGGATAAGATCGAAATTAACCGTGCACTGAACGATTTTCACGTAGTACCAGACCGTAGCCGC
CCACTGGATTATGAGGTTTTCGCCATTAATAAAGTGTTTGGTCAACAGGCGGAAACCAGCAACGAGGTGG
TATTTAACCCACTTTATCAAACCCGTCACTGTGATAATGGCAACTTTGGGCGTTATTTCTCCATCACCCG
CAAGGCCAGAACGGGCGATAGCAACAAAAGAAAATATGACACCCGCACGCCTTACGCCAGTACCGAGGTC
TTTGTCTCGTTGGTCGATCAACAAGAGGCTCCTTATGGCGATAGCTTGCGCTACCTCTCTATTGAAGCTC
AGGTGACTAATCGGGATCTTCCGCGCCTGATTTCCGCCAGTGGTAATTTTGAATTGACCATGTCGGATTC
AGCGCCCGTTCACGGTGCCCGGTTTGTCTTCCAACCCAGCGCCCCACGCGCCCCCTTTGCCATGGATGAA
TCCGCCTGGCGTTTGATTCGCCAATTGAGCTTCAACTATCTGCCACTGTCAGATATGTCCCACTCGAATG
GGGGGGAGTCACTGCGCAATATGCTACGTCTGTTTGTTAACGCTTCAGACCATGAATCGAATACACAAAT
TGACGCGCTGGTGGGCTGTAAAAGCGAGCCGGTGATCCGCCGGTTACCCGGCAATGGCCTACTGGTTTAT
GGCCGGGGCATCTGCTGCACTTTGACCGTGGATGAAGAAGGATTCTCCGGTATCAGCCCTTATCTATTTG
GCATGATCATGGAAAATTATGTGGCCCGCCATGCCGCAATAAATGTGTTTACCGAGACCGAGCTAAACTC
CATGCAAAGAGGACGTGTCGGTCATTGGAAAGCCCGCCCTGGCAGACGAGGAGTCCTGTAA