SecReT6
Protein ID: 162420092
SecReT6 ID242
T6SS typei2
Gene symbol-
Locus tagYpAngola_A0169
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]176329..178677 [-]
Producthypothetical protein
NoteTssI
UniProt IDA9R6S7
KEGG IDypg:YpAngola_A0169
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.60E-65, Aligned region: 34..355
DUF2345 [PF10106], Evalue: 5.40E-48, Aligned region: 611..751
T6SS_Vgr [PF13296], Evalue: 3.00E-35, Aligned region: 488..591
T6SS_Vgr [PF13296], Evalue: 3.00E-35, Aligned region: 629..651
Phage_base_V [PF04717], Evalue: 1.80E-16, Aligned region: 393..481
Protein Sequence: 782 a.a.     [Download]
>gi|162420092|ref|YP_001604797.1| hypothetical protein YpAngola_A0169 [Yersinia pestis Angola]
MNTTLPTLRFDHSHHKLVVRDSTAAVDVLGFEGHESLSQPFCYDIQFTSADKAIDPATMLMHDASLTLAA
PMAEAFGVTVQQTQRVIQGVVTGFKRLSASKEECRYELSLQPRLALLSRSHQNGIYQDMSVPQIVEKILR
ERHDMRGQDFVFTLAREYPRREQVMQYGEDDLTFIRRLLAEVGIWFRFTADPKLNIDVVEFYDDQRFYQQ
GLTLQAVPPSGMHDSGMESVWDLSSAHQVVEKSVSTGDYNYRTATADMTAGADITRGDTTTYGEAYHYAD
NYLTAGSEGREPESESGAFYARLRHERYLNNQARFAGVANAAALSPGQELKVTGNDVPAQFGKGVIVTRI
TSHARRDRSYEVHFEAIPYSEEYCFRPILINKPKMAGTLPARVTSTTVNDTYGHIDKDGRYRVNLMFDRD
SWEQGYESLWVRQARPYAGDSYGLHLPLLAGTEVAIAFEDGNPDRPYIASVLHDSAHGDHVTISNYKRNV
LRTPSNNKLRLEDERGKEHIKLSTEYGGKSQLNLGHLVDNEKQPRGEGFELRTDSFGALRAEKGIFISAD
GQAKAQGQVLEMQPAISLLKSAQEQMEAISADAQTATASPANLQVQISLLQQNLTELKQAVLLLSAPKGI
ALSSGEHLQLSASENLIATAGKNADVSVGKNFFIGVGNTLSVFVRKLGIKLIANQGRITVQAQNDLMELL
ARKAITITSTEDEIKITAKKKITLNAGGSYITLDENRIESGTAGEYLTKAGYYGRLDKAKLPTEFPALAA
KTEDPIKRWLFS
 
Nucleotide Sequence: 2349 bp     [Download]
>gi|162418099|ref|NC_010159.1|:c178677-176329 Yersinia pestis Angola chromosome, complete genome
ATGAATACCACTCTCCCGACTCTTCGGTTTGACCATAGCCACCACAAACTGGTGGTCCGCGACAGCACCG
CCGCCGTTGATGTGCTGGGCTTTGAAGGCCACGAAAGCCTGAGCCAGCCGTTCTGTTACGACATCCAATT
CACCAGCGCCGACAAGGCGATTGACCCGGCGACCATGCTGATGCACGACGCGTCACTGACATTGGCGGCC
CCGATGGCCGAAGCTTTTGGCGTGACGGTTCAGCAGACCCAGCGGGTGATCCAAGGGGTGGTGACCGGAT
TTAAACGCCTGTCGGCCTCGAAAGAGGAATGCCGCTACGAACTGAGCCTGCAACCGCGCCTGGCCTTGTT
GTCGCGCAGCCATCAGAACGGGATATATCAGGACATGTCGGTGCCGCAGATTGTGGAAAAAATTCTGCGT
GAGCGCCATGACATGCGCGGTCAGGATTTTGTCTTCACGCTGGCCCGCGAGTACCCACGCCGCGAGCAGG
TAATGCAATACGGCGAGGATGACCTGACCTTTATCCGCCGCCTGCTGGCCGAGGTGGGGATCTGGTTTCG
TTTTACCGCCGATCCCAAACTCAATATTGATGTGGTGGAGTTTTACGACGACCAGCGCTTCTATCAGCAA
GGACTGACGCTACAGGCGGTGCCGCCTTCGGGGATGCACGACAGCGGGATGGAGTCGGTCTGGGACTTGT
CCAGTGCTCATCAGGTGGTTGAAAAATCGGTCAGTACCGGCGATTACAACTACCGCACCGCGACTGCCGA
TATGACGGCCGGGGCAGACATCACTCGGGGTGATACCACCACCTACGGCGAAGCTTATCATTACGCCGAT
AACTACCTGACCGCAGGCAGTGAAGGGCGCGAGCCGGAAAGTGAAAGCGGGGCCTTTTATGCCCGTCTGC
GCCATGAACGTTACCTCAATAATCAGGCGCGCTTCGCCGGGGTGGCCAATGCGGCGGCACTGTCACCGGG
TCAGGAACTGAAAGTCACCGGCAACGACGTGCCAGCACAGTTTGGCAAAGGGGTGATAGTCACCCGCATC
ACCAGCCACGCCCGCCGCGACCGCAGCTATGAAGTGCATTTTGAGGCCATCCCTTACTCCGAAGAGTATT
GCTTCCGCCCGATCCTCATCAACAAGCCAAAAATGGCCGGCACCTTGCCCGCACGGGTCACCAGCACCAC
GGTGAACGACACTTACGGACACATCGACAAAGACGGCCGCTACCGTGTCAATCTGATGTTTGACCGGGAC
AGTTGGGAGCAAGGCTACGAAAGCCTGTGGGTCCGTCAGGCCCGCCCGTATGCGGGTGACAGCTACGGCC
TGCACCTGCCGCTGCTGGCCGGCACCGAAGTGGCGATTGCATTTGAGGACGGCAACCCGGACCGGCCGTA
TATCGCCTCTGTGCTGCACGACTCGGCGCACGGCGACCACGTCACCATCAGCAACTACAAACGCAACGTA
CTGCGCACTCCGTCGAACAACAAACTGCGCCTGGAGGATGAACGGGGCAAAGAGCACATCAAGCTCAGCA
CCGAATACGGCGGCAAAAGCCAGTTGAATCTGGGGCATCTGGTCGATAACGAGAAACAGCCTCGGGGTGA
GGGTTTTGAGCTGCGCACCGACAGTTTTGGTGCCTTGCGGGCAGAAAAAGGGATTTTCATCAGCGCTGAC
GGCCAGGCGAAGGCACAGGGGCAGGTGCTGGAGATGCAACCGGCTATCAGCCTGTTGAAAAGTGCGCAGG
AACAGATGGAGGCCATCTCCGCGGATGCACAAACCGCCACCGCCAGTCCGGCCAACCTACAGGTACAAAT
CAGTCTGTTGCAGCAAAATCTCACTGAACTGAAACAAGCTGTCCTGTTACTGAGTGCGCCAAAGGGGATC
GCGTTGAGCAGTGGCGAACATTTACAACTGTCGGCCAGCGAAAATCTGATAGCCACTGCCGGTAAGAATG
CGGATGTCAGTGTAGGTAAGAATTTTTTTATCGGTGTGGGCAACACGCTGAGCGTATTTGTACGCAAGCT
GGGGATAAAGTTGATAGCGAATCAGGGACGAATAACGGTACAGGCCCAGAATGATCTGATGGAGTTATTG
GCGCGTAAAGCGATCACGATCACCAGCACCGAGGATGAGATAAAAATCACCGCCAAGAAGAAGATCACGC
TGAATGCGGGAGGCAGTTATATCACGCTGGATGAGAACCGGATCGAGTCAGGAACGGCGGGGGAATATTT
GACCAAAGCAGGGTATTACGGGCGGTTAGATAAGGCCAAGCTCCCAACTGAATTTCCAGCCTTAGCCGCT
AAAACTGAAGACCCCATTAAACGTTGGCTATTCTCTTAA