SecReT6
Protein ID: 162420583
SecReT6 ID246
T6SS typei3
Gene symbol-
Locus tagYpAngola_A2874
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3016844..3017383 [+]
Producttype VI secretion lipoprotein
NoteTssJ
UniProt IDA9R0N7
KEGG IDypg:YpAngola_A2874
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.50E-36, Aligned region: 22..172
Protein Sequence: 179 a.a.     [Download]
>gi|162420583|ref|YP_001607255.1| type VI secretion lipoprotein [Yersinia pestis Angola]
MNKSIRGVYRATQYLFLVLVTLLTIACSSKVQPEKAEKLTVEIATAADINPNDKGVANPLRIALYTLKST
DEFQSSDFFTITEENTPSLKEQMDNVFDRIMLPSETKKIELTLDAGVTAIGIVAAYREIEQAEWKAVIYP
LPKKRVDPWYKKMWPGQDQQDPIMKVRVERLSISIKEMD
 
Nucleotide Sequence: 540 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3016844-3017383 Yersinia pestis Angola chromosome, complete genome
ATGAATAAAAGTATCCGAGGGGTTTACCGGGCGACACAGTACTTATTTTTGGTACTGGTAACGTTATTGA
CGATAGCCTGTAGTTCAAAAGTGCAACCTGAAAAGGCTGAAAAGCTTACCGTCGAAATCGCGACAGCAGC
GGATATTAATCCGAATGATAAAGGGGTGGCGAACCCGCTAAGGATTGCACTTTATACACTCAAGAGCACC
GATGAATTTCAGTCGAGTGATTTCTTCACTATCACTGAAGAAAATACGCCATCGCTAAAAGAACAAATGG
ATAACGTGTTTGACCGGATTATGTTGCCAAGCGAGACCAAAAAAATAGAGCTGACACTTGATGCTGGCGT
TACTGCTATCGGCATCGTGGCTGCTTATCGTGAAATTGAACAGGCGGAGTGGAAAGCGGTTATTTATCCG
TTGCCCAAAAAACGCGTGGATCCTTGGTATAAAAAAATGTGGCCAGGGCAAGACCAACAAGATCCGATCA
TGAAGGTACGCGTTGAGCGTCTGTCAATATCAATTAAAGAAATGGATTAA