SecReT6
Protein ID: 162420998
SecReT6 ID801
T6SS typei1
Gene symbol-
Locus tagYpAngola_A3903
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]4146737..4147177 [-]
Producthypothetical protein
NoteTssE
UniProt IDA9R521
KEGG IDypg:YpAngola_A3903
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-19, Aligned region: 32..122
Protein Sequence: 146 a.a.     [Download]
>gi|162420998|ref|YP_001608204.1| hypothetical protein YpAngola_A3903 [Yersinia pestis Angola]
MAALLNWDRGSSASLFDRIQGKGASSSSDGRLRELLNSIQKHLNEVLNSRPGACQSAVDLGVIDLNDATA
TSSDFRKSIEKAIKDCIENYEPRISAVTVQSLLNHGDPLQLSFHISARVNFDDMGDVVEFNIQLDNNRRY
CFNQET
 
Nucleotide Sequence: 441 bp     [Download]
>gi|162418099|ref|NC_010159.1|:c4147177-4146737 Yersinia pestis Angola chromosome, complete genome
ATGGCCGCGCTTCTTAATTGGGATCGAGGGAGTTCTGCCAGTTTGTTTGACCGCATACAGGGGAAGGGCG
CTAGCTCTTCCTCCGATGGCCGTCTGCGTGAGCTATTGAATTCAATCCAAAAGCATTTGAACGAGGTCCT
TAACTCTCGTCCAGGTGCTTGCCAAAGTGCGGTCGATCTCGGGGTTATCGACCTCAATGATGCGACCGCC
ACCTCATCTGATTTTCGAAAAAGTATTGAGAAAGCCATTAAGGATTGTATCGAGAACTACGAACCCCGAA
TTTCTGCCGTTACAGTTCAATCCTTGCTGAACCATGGCGACCCACTGCAACTGAGTTTCCATATTAGCGC
TCGTGTTAATTTCGACGATATGGGTGATGTCGTTGAGTTCAACATTCAGTTAGACAATAACCGCCGTTAC
TGCTTTAACCAGGAAACATAA