SecReT6
Protein ID: 162421327
SecReT6 ID244
T6SS typeN/A
Gene symbol-
Locus tagYpAngola_A1934
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]2003269..2005893 [-]
Producthypothetical protein
NoteTssI
UniProt IDA9R769
KEGG IDypg:YpAngola_A1934
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.00E-76, Aligned region: 18..336
Phage_base_V [PF04717], Evalue: 3.80E-24, Aligned region: 376..469
Protein Sequence: 874 a.a.     [Download]
>gi|162421327|ref|YP_001606408.1| hypothetical protein YpAngola_A1934 [Yersinia pestis Angola]
MPYLLGEPALVLSKLEGEEAFSTLYSYTITAKTPANPLIPWQAASNVDLKSLIGKEMTIEMELDGNGLGD
VRSVGKGTREITGLVERARYIGRDANQAIFEITIKPWFYLANLTSDFKIYQNKNVVDIIEEVFSDYNFPF
EKRLATTYPILDFQVQYGETDFNFLQRLMEEWGIYWFFEHQDHKQKLILVDHVGAHKRSFSTAYHAIEYL
SDEPKAGEEYITQFQTQETLTSGTWVTNDYDFTKSRADILAMDSKPRKTSFNDLEIYHWPGDYDQPDIGE
HLSRVRIEERGALGSRAVGSGQLRGIVCGANFELKGFPVDKANREYMIISSRLTVAEVDQLSGGEDAFSC
ESSFTVQPTTKIYRHPQVTPKPKTNGPQNAIIVGPPGEEIWTDEYGRVKVRFVWDRYGTNSESDSCWLRV
SQAWAGNSFGGIYIPRIGQEVIVDCINGDPDRPMVMGSLYNNVTRPPWDLPANATQSGMVSRTVGGGLTN
YNGVRFEDKSGLEQYWEQAERDMSRLTKNNETQIIGADSVLNVGANRSEVVGANYNQDVLGTSMLAIGAA
SMLQVGLARSVVVGGAHSLNVVLANATNVGGANMTNVGGFNGLAVGGAHQTAVGGAATLAAGGPIAIGAG
GELILSGDIVKIVGKSKVIIQGGEVHINSDDCCGRKTGNGGGAFGAFASLAGLLPLAGAIALPLPLPLLP
IVVPPVTSPPDPTLPPDPTLPPDPTLPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPP
ETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTAPPETTA
PPETTAPPETTAPPETTAPPEPTRTPPGTQTPPP
 
Nucleotide Sequence: 2625 bp     [Download]
>gi|162418099|ref|NC_010159.1|:c2005893-2003269 Yersinia pestis Angola chromosome, complete genome
ATGCCTTATCTATTGGGTGAGCCTGCGCTGGTACTGTCTAAGTTGGAAGGCGAGGAAGCCTTTTCGACTT
TATATTCTTATACTATTACGGCAAAGACACCGGCTAACCCATTAATTCCTTGGCAAGCGGCTTCAAATGT
CGATCTCAAATCCTTAATTGGTAAAGAGATGACGATTGAAATGGAACTGGACGGCAACGGCCTGGGTGAT
GTGAGAAGTGTAGGTAAAGGCACGCGTGAAATTACGGGGCTGGTTGAGAGAGCCAGATACATTGGTCGAG
ATGCCAATCAGGCCATATTTGAGATCACTATTAAGCCTTGGTTCTACCTGGCTAATTTAACCTCTGACTT
TAAAATTTATCAAAATAAAAATGTCGTTGATATTATAGAGGAAGTGTTCTCAGACTATAATTTTCCGTTT
GAGAAACGGTTGGCTACAACCTATCCGATATTAGATTTTCAGGTTCAGTACGGTGAAACCGACTTTAATT
TCCTTCAGCGTTTGATGGAAGAGTGGGGTATTTACTGGTTCTTTGAGCATCAGGATCATAAACAAAAATT
AATTCTTGTGGATCATGTCGGTGCGCATAAACGCTCGTTCAGTACCGCCTACCATGCCATTGAGTACTTG
TCGGATGAGCCTAAAGCGGGCGAAGAGTACATCACACAATTCCAGACTCAGGAAACCTTGACGAGTGGGA
CCTGGGTCACCAACGATTATGACTTCACGAAATCCCGTGCCGATATTCTGGCAATGGACAGTAAACCGCG
TAAAACCAGCTTTAACGATCTCGAGATTTATCACTGGCCAGGGGATTATGATCAGCCAGATATTGGTGAG
CACCTTTCACGCGTGCGTATCGAAGAACGTGGTGCTCTGGGTTCGCGGGCGGTCGGTTCTGGTCAACTGC
GCGGGATAGTTTGTGGTGCTAACTTCGAGCTGAAAGGGTTCCCCGTTGATAAAGCGAATCGGGAATACAT
GATTATCTCCAGCCGTTTGACGGTGGCTGAAGTTGATCAACTGTCTGGCGGTGAGGATGCGTTTAGTTGC
GAGAGTTCTTTCACGGTTCAGCCGACGACCAAAATCTATCGTCACCCACAGGTGACACCAAAACCGAAAA
CCAATGGGCCGCAAAACGCCATTATTGTGGGGCCACCGGGTGAAGAGATTTGGACCGATGAATATGGCCG
CGTAAAAGTGCGTTTCGTTTGGGATCGCTATGGCACAAACAGCGAGTCAGACTCTTGCTGGCTACGTGTT
AGCCAGGCTTGGGCAGGGAACAGCTTTGGTGGGATCTATATTCCACGCATTGGTCAGGAAGTCATTGTTG
ACTGTATTAACGGCGATCCTGACCGGCCAATGGTGATGGGCAGCCTTTATAATAACGTGACGCGTCCCCC
TTGGGACCTGCCTGCCAATGCGACGCAAAGTGGCATGGTCAGTCGTACCGTTGGCGGCGGGTTAACCAAC
TATAACGGCGTTCGTTTTGAAGATAAATCGGGGCTGGAGCAGTACTGGGAACAGGCCGAGCGCGATATGT
CGCGTTTGACTAAAAATAATGAAACGCAAATTATCGGTGCCGATTCTGTCCTGAATGTAGGGGCCAACCG
AAGTGAAGTTGTCGGGGCCAATTATAACCAAGATGTTCTTGGCACATCAATGTTAGCCATCGGTGCAGCC
TCTATGCTACAGGTGGGATTGGCGCGTAGCGTTGTGGTTGGCGGAGCACATTCACTGAATGTGGTTTTGG
CGAATGCCACCAATGTGGGTGGCGCTAACATGACCAACGTAGGGGGGTTTAATGGCCTTGCGGTGGGGGG
AGCCCATCAGACAGCTGTAGGCGGTGCTGCGACACTGGCTGCCGGCGGCCCTATTGCTATTGGGGCGGGT
GGTGAGCTTATCCTCAGTGGGGATATCGTAAAAATTGTTGGTAAAAGTAAGGTTATTATTCAGGGCGGTG
AAGTTCACATTAACTCTGATGATTGTTGTGGTCGTAAAACGGGCAATGGCGGCGGGGCATTCGGTGCCTT
TGCGAGCCTGGCAGGTTTATTGCCGCTGGCGGGTGCTATTGCCTTACCGCTACCGTTACCCTTGTTGCCA
ATAGTGGTGCCACCAGTGACATCGCCACCGGATCCGACATTGCCACCAGATCCAACGTTGCCACCAGATC
CAACGTTACCGCCGGAAACCACGGCACCGCCAGAAACAACGGCACCGCCAGAGACAACGGCACCGCCGGA
AACAACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCAGAAACAACGGCACCGCCG
GAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCACCGC
CGGAAACCACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACCGCCAGAGACAACGGCACC
GCCGGAAACCACGGCACCGCCAGAAACCACGGCACCGCCGGAAACAACGGCACCGCCGGAAACAACGGCA
CCGCCAGAAACAACGGCACCGCCGGAAACAACGGCACCGCCAGAAACAACGGCACCGCCGGAACCGACGC
GAACACCGCCAGGGACGCAGACGCCACCGCCTTGA