SecReT6
Protein ID: 162421474
SecReT6 ID247
T6SS typei2
Gene symbol-
Locus tagYpAngola_A2978
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3138568..3139068 [+]
Producthypothetical protein
NoteTssB
UniProt IDA9R179
KEGG IDypg:YpAngola_A2978
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.40E-56, Aligned region: 7..159
Protein Sequence: 166 a.a.     [Download]
>gi|162421474|ref|YP_001607350.1| hypothetical protein YpAngola_A2978 [Yersinia pestis Angola]
MFSSSFQNEIPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGQEQRPLSEREKLNINKNNFNSVLAE
FQPSLKLAVPDTLAGDNTDTAVSLTFNDMKDFEPENVARQIPQLRALLAMRNLLRDLKSNLLDNATFRRE
LENILKDDALSDELRAELAALAPKEG
 
Nucleotide Sequence: 501 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3138568-3139068 Yersinia pestis Angola chromosome, complete genome
ATGTTCTCTTCAAGCTTCCAAAATGAGATACCTAAAGCACGCATTAACATCAAATTAGACCTGCATACTG
GCGGGGCGCAAAAGAAAGTCGAACTGCCTTTGAAGTTGTTGGTGATGGGCGATTACAGCAACGGTCAGGA
GCAGCGCCCGCTGTCTGAACGTGAAAAACTCAATATCAATAAAAATAATTTTAACAGTGTGCTGGCTGAA
TTCCAACCGAGCCTGAAACTCGCTGTACCGGACACGCTGGCCGGGGATAACACCGATACAGCCGTCTCCC
TGACCTTCAACGACATGAAAGATTTCGAGCCAGAAAACGTGGCCCGTCAAATTCCGCAACTGCGTGCCTT
GCTGGCCATGCGCAACCTGCTGCGAGACCTTAAATCCAATCTGCTGGACAACGCCACCTTCCGCCGTGAG
CTGGAAAATATCCTCAAAGACGATGCCTTGAGCGATGAACTGCGCGCTGAACTGGCGGCCCTGGCGCCAA
AAGAGGGTTAA