SecReT6
Protein ID: 162421644
SecReT6 ID246
T6SS typei3
Gene symbol-
Locus tagYpAngola_A2872
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3014278..3015780 [+]
Producthypothetical protein
NoteTssC
UniProt IDA9R0N5
KEGG IDypg:YpAngola_A2872
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-194, Aligned region: 68..494
Protein Sequence: 500 a.a.     [Download]
>gi|162421644|ref|YP_001607253.1| hypothetical protein YpAngola_A2872 [Yersinia pestis Angola]
MSTQDAKTKQATVASATEYSDFNTLLTKEFKAKSEQTIAAVEGAVKTLAEQALANSVTVSDDAYKSIASI
IAEIDRKLSDQINLILHHQEFQSLESAWRGLHYLVNNTETDEKLRLRFLDISKDELRRNMKRYKGVAWDQ
SPLFKKIYEEEYGQLGGEPYGCLVADYYFDHTAPDVDLLASIGKVAASAHVPFITGAAPSVLQMESWQEL
SNPRDLTKIFTQNLEYAAWNSLRQSEDSRYIGLAMPRFLSRLPYGINTNPVDAFHFEETTDGADHSKYVW
SNAAYAMAVNINRSFKEYGWCTLIRGVESGGVVEGLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNG
FIPLVHRKNTDYAAFIGAQSLQKPAEYYDSDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERD
EMQRWLNDWVMNYVDGDPANSSLETKARRPLAAAEVIVEEVEGNPGYYQAKFFLRPHFQLEGLTVSLRMV
AKLPSLKDVA
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3014278-3015780 Yersinia pestis Angola chromosome, complete genome
ATGTCCACTCAAGACGCAAAAACTAAACAAGCTACAGTCGCCAGTGCGACGGAATATAGCGATTTTAATA
CATTACTGACTAAAGAATTTAAAGCGAAGTCTGAGCAAACGATAGCCGCAGTAGAAGGTGCCGTTAAAAC
GTTGGCTGAGCAAGCGCTGGCTAATTCGGTCACGGTGTCAGACGATGCTTATAAAAGTATTGCTTCCATT
ATTGCAGAGATTGATCGCAAGCTATCAGATCAGATTAACTTAATTTTGCACCACCAAGAATTCCAGTCTC
TGGAAAGCGCATGGCGTGGGCTGCACTATTTAGTCAATAACACCGAGACTGATGAGAAGTTGAGATTACG
TTTCCTCGACATTTCTAAAGATGAATTACGCCGTAACATGAAGCGTTATAAAGGTGTTGCTTGGGATCAA
AGCCCATTATTCAAAAAAATCTATGAAGAAGAATATGGCCAATTGGGTGGCGAACCATACGGTTGCCTGG
TAGCAGACTATTACTTTGACCATACTGCACCTGACGTTGACTTGTTGGCTTCAATTGGCAAAGTTGCCGC
TTCTGCCCACGTGCCATTTATTACAGGTGCTGCACCGTCTGTGTTGCAAATGGAATCTTGGCAAGAACTG
TCAAACCCACGTGATTTGACGAAGATCTTCACTCAGAATCTTGAGTATGCCGCATGGAACTCACTGCGTC
AGTCTGAAGACTCTCGCTATATCGGCCTGGCGATGCCACGTTTCTTGTCGCGTCTGCCTTATGGGATTAA
CACCAATCCGGTAGATGCCTTCCACTTTGAAGAGACGACTGATGGCGCGGATCACAGCAAATATGTGTGG
TCAAATGCGGCTTATGCGATGGCTGTTAACATCAACCGATCTTTCAAAGAGTATGGCTGGTGTACGCTGA
TTCGTGGTGTGGAAAGTGGTGGTGTTGTTGAAGGCCTGCCATGCCATACCTTCCCGACGGATGACGGCGG
TATTGATATGAAATGCCCAACAGAAATCGCTATTTCTGACCGTCGTGAAGCGGAACTGGCCAAGAATGGC
TTTATTCCACTGGTTCACAGAAAGAATACGGATTACGCGGCATTCATTGGCGCGCAGTCCCTGCAAAAAC
CTGCAGAATATTACGATTCGGATGCAACGGCGAACGCCAACCTTTCCGCTCGTCTGCCATACCTGTTTGC
TTGTTCACGTTTTGCACATTATCTGAAGTGCATCGTGCGTGACAAAATCGGCTCTTTTAAAGAGCGTGAT
GAGATGCAACGTTGGTTGAATGATTGGGTGATGAACTATGTTGATGGTGACCCAGCTAACTCTTCCCTGG
AAACTAAAGCGCGCCGTCCTTTAGCCGCCGCTGAAGTGATTGTTGAAGAAGTTGAAGGTAACCCTGGTTA
CTATCAGGCTAAATTCTTCTTACGCCCTCATTTCCAGTTAGAAGGTTTGACAGTATCCCTGCGTATGGTT
GCTAAACTGCCTTCGCTGAAAGACGTAGCATAA