SecReT6
Protein ID: 162421867
SecReT6 ID247
T6SS typei2
Gene symbol-
Locus tagYpAngola_A2979
StrainYersinia pestis Angola
Repliconchromosome [GenBank: NC_010159] [Browse all T6SS(s) in this replicon]
Location [Strand]3139117..3140106 [+]
Producthypothetical protein
NoteTssC
UniProt IDA9R180
KEGG IDypg:YpAngola_A2979
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.90E-38, Aligned region: 13..51
DUF877 [PF05943], Evalue: 6.90E-38, Aligned region: 90..191
DUF2077 [PF09850], Evalue: 1.10E-26, Aligned region: 94..123
DUF2077 [PF09850], Evalue: 1.10E-26, Aligned region: 127..147
DUF2077 [PF09850], Evalue: 1.10E-26, Aligned region: 192..317
Protein Sequence: 329 a.a.     [Download]
>gi|162421867|ref|YP_001607351.1| hypothetical protein YpAngola_A2979 [Yersinia pestis Angola]
MSVQENRAQGTATTVLKNSPAAQGVYAALFEKINLSPVSSLAGIEAFQNNDALAEATTDERVTAAVSVFL
DLLKQSAKKVEKLDKTLLDGHIAALDDQISRQLDAVMHHPDFQRVESTWRGVKSLIDQTDFRQNVRIELL
DISKDHLVQDFEDAPEISQSGLYAQTYIQEYDTPGGEPIAAAISNYDVQDDAYFVWCHSPLQAHFFNTLD
AGSQLYERMRAVLREPAPDRAVLTCFHRVLMLGFLGGYASPAASEREQLIDQLSVQVPAFSVAPSRGILA
SAASRNRLGIWLRYWPVRLGLAALMVALLWWGLDHWLSGLLATLLPEPV
 
Nucleotide Sequence: 990 bp     [Download]
>gi|162418099|ref|NC_010159.1|:3139117-3140106 Yersinia pestis Angola chromosome, complete genome
ATGTCTGTACAGGAAAACCGTGCGCAGGGTACTGCGACGACCGTATTAAAGAATAGCCCTGCGGCACAAG
GGGTTTACGCCGCCTTGTTTGAAAAAATCAACCTGAGCCCGGTCTCCTCACTGGCCGGTATCGAGGCGTT
CCAGAACAACGATGCGCTGGCGGAAGCCACCACCGATGAGCGCGTTACCGCCGCCGTCAGTGTCTTTTTA
GACCTGCTGAAGCAGTCGGCGAAGAAAGTAGAAAAACTGGATAAAACCCTGCTGGACGGCCATATTGCCG
CACTGGATGACCAAATCAGCCGCCAGTTGGACGCGGTAATGCACCACCCCGATTTCCAGCGGGTGGAATC
GACCTGGCGTGGTGTGAAGTCGCTGATCGATCAGACCGATTTCCGCCAGAACGTGCGCATCGAGCTGCTG
GATATCAGTAAAGATCATCTGGTGCAGGATTTTGAAGATGCCCCGGAAATCTCACAAAGCGGTTTATACG
CCCAGACCTATATTCAGGAATACGACACCCCCGGCGGCGAGCCGATTGCCGCGGCTATCTCCAACTACGA
TGTACAGGATGATGCCTACTTCGTGTGGTGCCATTCGCCCTTACAGGCGCATTTTTTCAATACCCTGGAT
GCCGGTAGCCAGCTTTACGAGCGGATGCGCGCCGTGTTGCGTGAGCCTGCGCCGGATCGCGCGGTACTGA
CCTGTTTTCACCGGGTATTGATGTTGGGCTTCCTCGGCGGGTACGCCTCCCCGGCGGCTTCTGAACGGGA
GCAACTGATCGATCAACTGAGCGTGCAGGTACCGGCGTTCAGTGTCGCGCCATCACGTGGGATCCTGGCA
AGCGCCGCCTCCCGCAACCGGTTGGGGATCTGGTTGCGTTACTGGCCGGTACGGCTCGGGCTGGCTGCGC
TGATGGTTGCGCTGTTGTGGTGGGGCCTTGATCACTGGCTGTCCGGTCTGTTAGCCACCTTACTGCCGGA
GCCGGTGTAA