SecReT6
Protein ID: 163856757
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2445
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2562518..2564068 [+]
Producthypothetical protein
NoteTssA
UniProt IDA9IN50
KEGG IDbpt:Bpet2445
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-19, Aligned region: 51..111
Protein Sequence: 516 a.a.     [Download]
>gi|163856757|ref|YP_001631055.1| unnamed protein product [Bordetella petrii DSM 12804]
MPTAGFDRNLGASPIRADRPVGDNPRDGETFAAMRAQIDQLTDIHASAVVDWEAVTRLGTQILNEEGKDL
SVGAWLTLALLHTRALAGLADGVHVLRDLVATYWDEMSPPAARLRGRRNQIQWLLDQLSERIQDPQAEFA
ALKPDVHSGLLADWEALDAAWQQHDDEVPAFYGLRAALTNLPVERPAEAAPATPPTGAAAGAPAAASATA
MVAPAAAPVAGSDPEAVAEAGLAGLRPLIDWYLQEHPTLPLLYRLNRICAWATLEQAPPVQNGATRLPPP
PDQVMVGFEKIAQGGDPEAVIHFAESRLIGHRYWLDLNRASHAALSRLGAKDAALVVAFETGRLLARLPQ
LAQMKFNDGRPFADPDTQAWLEALGGETPRAAGSADPVAELAAAADADAVAGKLNEALDNLQAAARHAGS
QRDNFRLRLAQCALLQRFDARADMRPLLATLIEELDAHRLATWEPDLARQALKLAATVELRYGAPGAGPN
ESMLARLASLDLRAAWQLSQSTTAAA
 
Nucleotide Sequence: 1551 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2562518-2564068 Bordetella petrii DSM 12804 chromosome, complete genome
GTGCCAACTGCAGGGTTCGATCGCAATCTGGGCGCCAGCCCTATCCGTGCCGACCGGCCGGTGGGCGACA
ACCCGCGCGATGGCGAAACGTTTGCGGCCATGCGCGCGCAGATCGACCAGTTGACCGACATCCATGCAAG
CGCGGTGGTGGACTGGGAGGCGGTCACGCGGCTGGGCACGCAGATACTTAATGAAGAAGGCAAGGACCTG
TCAGTGGGGGCATGGCTGACCCTGGCCTTGCTGCACACCCGTGCGTTGGCGGGGCTGGCCGATGGCGTGC
ATGTGCTGCGCGACCTGGTGGCCACGTACTGGGACGAGATGTCTCCGCCCGCGGCACGGCTGCGCGGCCG
GCGCAACCAGATCCAGTGGCTGCTGGATCAACTGAGCGAGCGCATCCAGGACCCGCAAGCCGAGTTCGCC
GCCCTGAAGCCGGACGTGCACAGCGGATTGCTGGCCGACTGGGAAGCGCTGGATGCGGCGTGGCAGCAGC
ACGACGATGAGGTGCCGGCGTTCTATGGCCTGCGCGCCGCGCTGACGAACCTGCCGGTGGAACGTCCCGC
CGAGGCGGCGCCCGCGACGCCCCCGACCGGTGCGGCCGCCGGCGCGCCCGCCGCTGCCTCCGCCACGGCG
ATGGTGGCGCCGGCCGCCGCGCCCGTGGCCGGCAGCGATCCGGAGGCGGTGGCCGAAGCGGGGCTGGCCG
GCCTGCGTCCGCTGATCGATTGGTATCTGCAAGAGCACCCCACCCTGCCGTTGTTGTACAGGCTGAACCG
CATTTGCGCCTGGGCGACGTTAGAGCAGGCGCCGCCCGTCCAGAACGGCGCAACGCGCCTGCCTCCCCCG
CCCGATCAGGTAATGGTCGGGTTCGAGAAAATCGCTCAAGGCGGCGACCCGGAGGCGGTGATCCATTTCG
CGGAGTCGCGCCTGATCGGCCACCGCTATTGGCTGGACTTGAACCGCGCCAGCCATGCCGCGCTGAGCCG
GTTGGGCGCCAAGGACGCGGCTCTGGTCGTGGCCTTCGAAACCGGCCGCCTGCTGGCGCGTCTGCCGCAG
TTGGCGCAAATGAAGTTCAACGACGGCCGCCCGTTCGCCGATCCCGACACCCAGGCGTGGCTGGAAGCGC
TGGGAGGCGAAACGCCGCGTGCGGCCGGCAGCGCGGACCCCGTGGCCGAACTGGCCGCGGCCGCCGACGC
CGACGCGGTGGCCGGCAAGTTGAACGAGGCGCTGGACAACCTGCAGGCCGCCGCGCGCCATGCCGGCAGC
CAGCGCGACAACTTCCGCTTGCGCCTGGCGCAATGCGCCCTGCTCCAACGTTTTGATGCGCGTGCCGACA
TGCGTCCGCTGCTGGCCACGCTGATTGAAGAACTCGACGCCCACCGCCTGGCCACTTGGGAACCCGATCT
GGCGCGGCAAGCCCTGAAGCTGGCGGCGACCGTCGAACTGCGATACGGCGCGCCTGGCGCCGGACCCAAT
GAATCCATGCTGGCCCGTCTGGCCAGCCTGGATTTGCGGGCCGCTTGGCAACTTTCGCAGTCCACCACCG
CCGCCGCCTAA