SecReT6
Protein ID: 163856758
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2446
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2564095..2564613 [+]
Producthypothetical protein
NoteTssB
UniProt IDA9IN54
KEGG IDbpt:Bpet2446
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.30E-56, Aligned region: 5..159
Protein Sequence: 172 a.a.     [Download]
>gi|163856758|ref|YP_001631056.1| unnamed protein product [Bordetella petrii DSM 12804]
MANDGSVAPKERVNIVYKPATGDAQEQVELPLKQLVLGDFTLQESDTPLDERKPIQVDKDNFNDVLKAQG
LSVTMAVPNRLSEGESDESLPVTLKFENIRDFEPDALVEQVPELRQLIELREALKSLKGPLGNLPDFRKK
LQALIQDEGARERLLSELGVQSAGPESDQSKE
 
Nucleotide Sequence: 519 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2564095-2564613 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCCAATGATGGATCCGTAGCCCCGAAAGAACGTGTCAACATCGTCTACAAGCCGGCCACCGGCGACG
CGCAGGAGCAGGTCGAACTGCCGTTGAAGCAACTCGTGCTGGGCGACTTCACGCTGCAGGAATCAGATAC
CCCGCTCGACGAGCGCAAGCCCATTCAGGTCGACAAGGACAACTTCAACGACGTGCTCAAGGCCCAGGGC
CTGAGCGTGACCATGGCGGTGCCCAACCGCCTGTCCGAAGGCGAAAGCGACGAATCACTGCCGGTCACCC
TGAAATTCGAGAACATCCGCGATTTCGAGCCCGACGCGCTGGTCGAGCAAGTGCCCGAGCTGCGCCAGTT
GATCGAGCTGCGCGAAGCGCTTAAGTCCCTGAAAGGCCCGCTGGGCAATCTTCCCGATTTCCGCAAGAAG
CTGCAGGCGCTCATTCAAGATGAAGGCGCGCGCGAACGCTTGCTGTCCGAATTGGGTGTGCAATCGGCCG
GCCCCGAGTCCGACCAGTCCAAGGAGTAA