SecReT6
Protein ID: 163856759
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2447
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2564617..2566104 [+]
Producthypothetical protein
NoteTssC
UniProt IDA9IN58
KEGG IDbpt:Bpet2447
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.30E-187, Aligned region: 68..493
Protein Sequence: 495 a.a.     [Download]
>gi|163856759|ref|YP_001631057.1| unnamed protein product [Bordetella petrii DSM 12804]
MSQESPQQQGAAQPAEQAGGSLIDQLIESTRVKPGDDAYSITRQGLEAFVAELLEPSRAQEKVSQGLIDE
MIAGLDRKLCRQVDAIMHQEQFQKLESAWRSLKFLVDRTDFRENNRIEILNVSKQALLEDFEDASDITRS
GLYKAVYTAEFGQFGGEPFGTIIGNYEFGPGGQDVKLLQSVASVAAMAHTPFIASAGPQFFGMDSYAGLP
NLKDLAAVFEGPQYTKWNAFRQTEDARFVGLTLPNFLLRVPYGDDTVPTKQFRYNEDVSGGSKDFLWGNA
AFAFASRLSESFAQYRWCANIIGPQGGGTVGDLPVYNYEAMGETQTKIPTEVLISERREFELAEQGFIAL
TMRKNTDNAAFFSANSVQKPKFFGNNKEGKEAELNYKLGTQLPYIFIVSRLAHYIKVIQRENIGTWKERT
DLESELNNWIRQYVADMDNPAAGVRSRRPLRQAEITVSDVEGDPGWYRVGLKVRPHFKYMGASFTLSLVG
KLDKS
 
Nucleotide Sequence: 1488 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2564617-2566104 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAGCCAGGAATCTCCCCAGCAACAGGGCGCGGCGCAACCCGCCGAACAGGCCGGTGGCTCGCTGATCG
ATCAGTTGATCGAATCGACCCGCGTCAAGCCCGGCGACGATGCGTATTCGATCACTCGCCAGGGGCTGGA
AGCCTTCGTGGCGGAGCTGCTCGAACCCAGCCGCGCGCAAGAGAAAGTCAGCCAGGGGCTCATCGACGAG
ATGATCGCCGGTCTGGACCGCAAGCTGTGCCGGCAGGTCGACGCGATCATGCACCAGGAACAGTTCCAGA
AGCTGGAATCGGCCTGGCGGTCGCTGAAGTTCCTGGTCGACCGGACCGATTTCCGCGAGAACAATCGCAT
TGAAATCCTGAATGTGTCCAAGCAGGCGCTGCTGGAAGATTTCGAGGACGCGTCGGACATCACGCGCTCG
GGCTTGTACAAGGCGGTGTACACGGCGGAATTCGGCCAGTTCGGGGGCGAACCGTTCGGCACCATCATCG
GCAACTATGAGTTCGGCCCCGGCGGGCAGGACGTCAAGCTGCTGCAATCGGTGGCCAGCGTCGCCGCCAT
GGCGCACACGCCGTTCATTGCCTCTGCCGGGCCGCAATTCTTCGGCATGGATTCCTATGCCGGCTTGCCC
AACCTGAAAGACCTGGCCGCGGTATTCGAAGGCCCGCAGTACACCAAGTGGAATGCCTTCCGGCAGACCG
AGGACGCGCGCTTCGTGGGCCTGACCTTGCCCAATTTCCTGCTGCGCGTGCCCTACGGCGACGATACGGT
GCCCACCAAGCAGTTCCGCTACAACGAGGACGTGTCGGGCGGCAGCAAGGATTTCCTGTGGGGCAATGCG
GCCTTCGCGTTCGCCAGCCGCCTGTCGGAGAGCTTCGCGCAGTACCGCTGGTGCGCCAACATCATCGGGC
CGCAAGGCGGCGGCACGGTGGGCGACTTGCCGGTCTACAACTACGAGGCCATGGGCGAGACGCAGACCAA
GATCCCCACCGAGGTGCTGATCTCGGAGCGGCGCGAATTCGAGCTGGCCGAACAGGGGTTCATTGCGCTG
ACCATGCGCAAGAACACCGACAACGCCGCGTTCTTCTCGGCCAATTCAGTGCAGAAGCCCAAGTTCTTCG
GCAACAACAAGGAAGGCAAGGAAGCCGAGCTGAACTACAAGCTCGGCACGCAATTGCCCTACATCTTCAT
TGTTAGCCGGCTGGCGCACTACATAAAGGTGATCCAGCGCGAAAACATCGGAACCTGGAAAGAGCGCACG
GATCTGGAATCGGAGCTCAATAACTGGATCCGCCAGTATGTGGCGGACATGGACAACCCGGCGGCCGGCG
TGCGCAGCCGCCGCCCGTTGCGCCAGGCCGAAATTACCGTGTCGGATGTGGAAGGTGATCCGGGATGGTA
CCGAGTGGGCCTGAAAGTGCGCCCGCACTTCAAGTACATGGGCGCGTCTTTCACGCTTTCCCTGGTGGGC
AAGCTCGACAAGAGCTGA