SecReT6
Protein ID: 163856762
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2450
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2567155..2568879 [+]
Producthypothetical protein
NoteTssF
UniProt IDA9IN62
KEGG IDbpt:Bpet2450
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.00E-153, Aligned region: 2..573
Protein Sequence: 574 a.a.     [Download]
>gi|163856762|ref|YP_001631060.1| unnamed protein product [Bordetella petrii DSM 12804]
MLNRYYEQELGYLRTLAAEFAASNPALAPLLGAGSASDPDVERLLEGVAFMTGLMRHRLDDDFPEFIQNL
AQLLFPHMLQPLPCMTIMRYQPRAALEGPVTIPAGTEFASVPVDGLRAIFRASFPVTLEPVELLGAQWEG
GGTQPRSLRLQFSLAGLPGAPWTGDSLRFFLGDAHADAARLYLLLLRYVREVRIGTDGGPLTVLPASAIQ
PAGLRPDLELMPWPRGAHPAWRVLHEYFALPEKLLFLDIAGFSRWTSRGTGDRFSVQIMFDRVPDWAPAV
GASSFILNATPAVNLFSHDAHPIRVDHLQPDYRIRPIARGSQSVEQIFSVDSVRARNANGDEQEYHAFSA
MQDEDAGSYHISIRASALHRGYDHFLSLPYSPGETPQPLTLSTRLTCTHGDLPQSLRLGDICEPTDSSPA
RVGFSNIQGITPHSPPVIDSTLLWRVLSHLNANHLALANEGQLRDLLSLYAPARQADAQRHAAARRAIES
IGQVQVEPVRRIVHGMPVQGNDVRIECRGDHFPGRGGLFLFGTVLDEFLAGTTAINTFSALTLVDVVNGE
TLQWPAKIGRYRLL
 
Nucleotide Sequence: 1725 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2567155-2568879 Bordetella petrii DSM 12804 chromosome, complete genome
GTGCTGAACCGCTACTACGAACAGGAGTTGGGCTATCTGCGGACGCTGGCGGCGGAATTCGCCGCCAGCA
ACCCCGCCCTGGCGCCGCTGCTTGGCGCCGGTAGCGCCAGCGACCCCGACGTAGAGCGGCTGCTGGAAGG
CGTGGCGTTCATGACGGGGCTGATGCGCCACCGCCTGGACGATGACTTCCCCGAGTTCATCCAGAACCTG
GCGCAGCTGCTGTTTCCGCACATGCTGCAACCCCTGCCCTGCATGACCATCATGCGCTACCAGCCGCGCG
CGGCCCTGGAAGGCCCGGTAACGATACCGGCCGGCACCGAGTTCGCCTCGGTGCCGGTGGATGGCTTGCG
GGCCATATTCCGGGCGTCGTTCCCGGTAACGCTGGAGCCGGTGGAATTGCTGGGCGCGCAATGGGAAGGC
GGCGGCACGCAGCCGCGTTCGCTACGGCTGCAGTTCAGCCTGGCGGGCCTGCCCGGCGCGCCCTGGACTG
GCGACAGCCTGCGGTTCTTCCTGGGCGACGCGCACGCGGACGCGGCGCGCCTGTACTTGCTGCTGCTGCG
CTACGTGCGCGAGGTCCGCATCGGCACCGACGGAGGACCCCTGACAGTGCTGCCGGCCAGCGCCATCCAG
CCAGCCGGCCTGCGCCCCGACCTGGAACTGATGCCCTGGCCCCGCGGCGCGCACCCGGCCTGGCGGGTGC
TGCACGAATACTTCGCCTTGCCCGAGAAACTGCTGTTCCTGGACATCGCCGGCTTTTCACGCTGGACCTC
GCGCGGAACGGGCGACCGCTTTTCGGTGCAGATCATGTTTGACCGGGTGCCGGACTGGGCGCCCGCGGTC
GGAGCGTCCAGCTTCATCCTGAATGCGACGCCGGCGGTCAATTTGTTCAGCCACGATGCGCATCCGATCC
GGGTCGATCATCTGCAGCCCGACTATCGCATCCGGCCCATTGCCCGGGGCAGTCAGTCGGTAGAGCAGAT
TTTCTCGGTCGACAGCGTGCGGGCCCGCAACGCCAATGGCGACGAACAGGAGTACCACGCTTTCTCGGCC
ATGCAGGATGAGGACGCGGGTTCGTACCACATCAGCATCCGCGCCTCGGCTCTGCATCGCGGCTACGACC
ACTTCCTGAGTTTGCCGTATTCCCCCGGCGAGACGCCTCAGCCCCTGACCCTTTCGACGCGGCTGACCTG
CACGCATGGCGACCTGCCGCAAAGCCTGCGGCTGGGCGACATCTGCGAGCCGACCGACAGTTCGCCGGCG
CGGGTGGGATTCAGCAATATCCAAGGCATTACGCCGCACAGCCCGCCGGTCATCGACAGCACGCTGTTGT
GGCGCGTGCTGTCGCACCTGAACGCCAACCACCTGGCCCTGGCCAACGAAGGCCAGCTGCGCGACCTGCT
GTCGCTGTACGCGCCGGCGCGCCAGGCGGACGCGCAGCGCCACGCCGCGGCCCGCCGCGCCATAGAGTCG
ATCGGCCAGGTGCAGGTGGAGCCGGTGCGCCGCATCGTGCATGGCATGCCGGTGCAAGGCAACGACGTGC
GCATCGAATGCCGCGGCGACCACTTTCCGGGCCGCGGCGGCCTGTTCCTGTTTGGCACGGTGCTGGACGA
ATTCCTGGCCGGCACCACGGCCATCAATACCTTCAGCGCTCTGACGCTGGTGGATGTCGTCAACGGAGAA
ACCCTGCAATGGCCAGCGAAGATCGGCCGCTATCGCCTGCTGTAG