SecReT6
Protein ID: 163856763
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2451
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2568843..2569889 [+]
Producthypothetical protein
NoteTssG
UniProt IDA9IN65
KEGG IDbpt:Bpet2451
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.10E-68, Aligned region: 22..314
Protein Sequence: 348 a.a.     [Download]
>gi|163856763|ref|YP_001631061.1| unnamed protein product [Bordetella petrii DSM 12804]
MASEDRPLSPAVAPPGGDPLLAQGHRYAFFQALRLLRLRSADAQAFSQDVRVRPSATLSFPDRDIEEIRL
DEIGKYRITANFFGLYGVTSPLPTFYTEDLIEEQLQGGSTARDFIDILHAALYPLLFRAWEKNRTWLAVA
ERRDANRLDHLYALVGMGGGAAARRPGVRRLLPHAGNFNQFPRSALGLESLAAGLLGALAVEVEPCVAEV
VAIPAPARCLLSEQACELGENAMLGSQIADRAGGLIMHIGPIPAGRLQELLPGAALHERLVRAIALYLRV
PLRCVLGLRVEPEQRRGASLGEGWCQLGLDTWLPEAAPGNPANPWPRYDEVFLPIDTDPTRISKEVMQ
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2568843-2569889 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCCAGCGAAGATCGGCCGCTATCGCCTGCTGTAGCGCCACCGGGCGGCGATCCGCTGCTGGCGCAAG
GGCACCGCTATGCCTTCTTCCAGGCGTTGCGGCTGCTGCGCCTGCGCAGCGCCGATGCGCAGGCGTTCTC
GCAGGATGTGCGGGTGCGCCCCTCAGCCACGCTGTCGTTTCCCGATCGCGACATCGAGGAAATCCGGCTC
GACGAAATCGGCAAATACCGGATCACCGCGAACTTCTTCGGCCTGTATGGCGTCACCTCGCCGCTGCCGA
CGTTCTACACCGAAGACCTGATCGAAGAGCAGCTGCAAGGCGGCTCGACGGCGCGCGATTTCATCGACAT
TCTGCATGCGGCGCTGTACCCGCTGCTGTTTCGCGCCTGGGAAAAGAACCGCACCTGGCTGGCGGTGGCC
GAGCGGCGCGATGCCAATCGCCTGGACCACTTGTACGCGCTGGTGGGCATGGGCGGCGGCGCGGCGGCGC
GCCGCCCCGGCGTGCGGCGCCTGCTGCCGCATGCCGGCAATTTCAACCAGTTCCCCCGCTCTGCGCTGGG
CCTGGAGTCGCTGGCGGCAGGGTTGCTGGGCGCGCTGGCCGTGGAGGTAGAGCCCTGCGTCGCTGAAGTG
GTGGCGATTCCGGCGCCCGCGCGCTGCCTGCTGTCGGAGCAGGCCTGCGAGTTGGGCGAGAACGCCATGC
TGGGCAGCCAGATCGCGGATCGGGCCGGCGGCCTGATCATGCATATCGGGCCGATTCCGGCCGGCCGCCT
GCAAGAGCTGCTGCCCGGCGCGGCGCTGCACGAACGCCTGGTGCGCGCCATTGCCCTGTATTTGCGCGTG
CCGCTGCGCTGCGTGCTGGGGCTGCGCGTCGAACCTGAGCAGCGGCGCGGCGCCAGCCTGGGCGAAGGCT
GGTGCCAGCTGGGCCTGGATACCTGGCTGCCCGAGGCGGCGCCGGGAAACCCGGCCAACCCATGGCCTCG
CTACGACGAAGTCTTCCTGCCGATCGACACCGATCCCACCCGTATTTCCAAAGAGGTCATGCAATGA