SecReT6
Protein ID: 163856764
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2452
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2569886..2572684 [+]
ProductClpA/B-type protease
NoteTssH
UniProt IDA9IN67
KEGG IDbpt:Bpet2452
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.50E-40, Aligned region: 229..246
AAA_2 [PF07724], Evalue: 7.50E-40, Aligned region: 664..828
AAA [PF00004], Evalue: 1.90E-20, Aligned region: 230..359
AAA [PF00004], Evalue: 1.90E-20, Aligned region: 669..802
ClpB_D2-small [PF10431], Evalue: 1.90E-13, Aligned region: 836..905
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 206..246
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 273..307
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 367..446
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 555..584
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 639..705
AAA_16 [PF13191], Evalue: 1.90E-12, Aligned region: 734..758
AAA_5 [PF07728], Evalue: 3.50E-10, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 3.50E-10, Aligned region: 302..359
AAA_5 [PF07728], Evalue: 3.50E-10, Aligned region: 668..786
AAA_22 [PF13401], Evalue: 6.70E-07, Aligned region: 228..315
AAA_22 [PF13401], Evalue: 6.70E-07, Aligned region: 519..560
AAA_22 [PF13401], Evalue: 6.70E-07, Aligned region: 666..689
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 224..250
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 627..641
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 666..690
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 29..76
Clp_N [PF02861], Evalue: 0.00011, Aligned region: 565..582
Sigma54_activat [PF00158], Evalue: 0.00027, Aligned region: 213..243
Sigma54_activat [PF00158], Evalue: 0.00027, Aligned region: 667..786
Arch_ATPase [PF01637], Evalue: 0.00031, Aligned region: 207..243
Arch_ATPase [PF01637], Evalue: 0.00031, Aligned region: 282..377
Arch_ATPase [PF01637], Evalue: 0.00031, Aligned region: 665..680
Arch_ATPase [PF01637], Evalue: 0.00031, Aligned region: 738..761
IstB_IS21 [PF01695], Evalue: 0.00065, Aligned region: 223..252
IstB_IS21 [PF01695], Evalue: 0.00065, Aligned region: 668..689
AAA_17 [PF13207], Evalue: 0.00079, Aligned region: 231..286
AAA_17 [PF13207], Evalue: 0.00079, Aligned region: 667..703
AAA_25 [PF13481], Evalue: 0.0026, Aligned region: 230..253
AAA_25 [PF13481], Evalue: 0.0026, Aligned region: 664..693
Zeta_toxin [PF06414], Evalue: 0.0051, Aligned region: 119..153
Zeta_toxin [PF06414], Evalue: 0.0051, Aligned region: 229..247
Zeta_toxin [PF06414], Evalue: 0.0051, Aligned region: 666..708
AAA_18 [PF13238], Evalue: 0.0079, Aligned region: 231..249
AAA_18 [PF13238], Evalue: 0.0079, Aligned region: 669..703
Protein Sequence: 932 a.a.     [Download]
>gi|163856764|ref|YP_001631062.1| unnamed protein product [Bordetella petrii DSM 12804]
MMLVELKPLFARLNSYCSAALEGAAGLTLARNHYEIAVEHMLRRLIEAPDGDAARILAHFDIDALRLTAQ
LDDALGQLKNGNPGRPVFAGLLTEWVQESWLTASITLGQSRVRSGAMLLALVARLSYYGAGTRYAETLRA
ISREQLAAEFDSIVDGSSETDLRIADAAGAGAATGAAGGAGAGEAAIGRFCEDFTAKARAGKIDPVFGRD
NEIRQMIDILARRRKNNPICVGEPGVGKTAVVEGLALRIVNGDVPEFLRDTRLLGLDLGLLEAGASVKGE
FENRLRGVIDEIKGSVKPIILFIDEAHMLIGAGGQSGGSDAANLLKPALARGELRTVAATTWSEYKKYFE
KDPALARRFQLVKLDEPDVHTAVQILRGLKDRYEAAHGVTVRDDAIVAAAELSDRYITGRLLPDKAVDLL
DTAAARVRIGLGVKPAELESLESRLAGLERERVALARDVQFQPGTYSERLGEIESERASLQAQHAELEAR
WKTEKEAAEAVLALRRQLGQAQNVPAVPTAQAPDGSTPEPTAEAAAEPAREPATDVSADTSTDTVTDTVT
DTSAQAAASPQALAAQLEEARNKLKNLQAGSPLVFIETDPDAVARVVSDWTGVPLGKMQRDAVSSVLALA
DRIKERIRGQDHAVDQIAATVKAAQSGLRDPQQPMGVFLLVGPSGVGKTETGLAVADQLFGGEHALVSVN
MSEFQEKHTVSRLVGSPPGYVGYGEGGVLTEAVRKRPYSVVLLDEVEKAHLDVVNLFYQVFDKGTLADGE
GRVIDFSNTVVFLTSNLATEEITRLARDGRPDVEALTTAIHPVLAKHFKPALLARMTVVPYYTLPPSELA
GIAELKLNKLASRLLAANRIQLSFDDAVRDTIAARCTEVDSGARNIDFILRKSLMPLLSDTVLSALADGR
ALSAIRVAPDDNGGWTLTTTEA
 
Nucleotide Sequence: 2799 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2569886-2572684 Bordetella petrii DSM 12804 chromosome, complete genome
ATGATGCTGGTAGAGCTAAAACCCCTGTTCGCGCGCCTGAACTCCTACTGCTCGGCGGCCCTGGAAGGCG
CGGCCGGCCTGACGCTGGCCCGCAACCATTACGAGATTGCCGTCGAGCACATGCTGCGCCGCCTGATCGA
AGCGCCCGACGGCGACGCCGCCCGCATCCTGGCGCACTTCGACATCGACGCGTTGCGCCTGACGGCGCAA
CTGGACGATGCGCTGGGCCAGCTGAAGAACGGCAATCCCGGGCGTCCGGTGTTCGCCGGCCTGTTGACCG
AATGGGTGCAGGAATCGTGGCTGACCGCCTCGATCACGTTGGGACAGAGCCGCGTGCGTAGCGGCGCCAT
GCTGCTGGCCCTGGTGGCGCGGCTGAGCTACTACGGCGCGGGCACGCGCTACGCCGAAACCTTGCGGGCC
ATCTCGCGCGAGCAACTGGCGGCCGAGTTCGACAGCATTGTCGACGGGTCGAGCGAAACCGACCTGCGCA
TCGCCGACGCCGCGGGCGCCGGGGCCGCCACGGGCGCGGCAGGCGGCGCCGGCGCCGGCGAAGCCGCCAT
CGGGCGCTTCTGCGAAGACTTCACCGCCAAAGCGCGTGCCGGCAAGATCGACCCGGTGTTCGGGCGCGAC
AATGAAATCCGGCAGATGATCGACATTCTTGCGCGCCGCCGCAAGAATAATCCGATCTGCGTGGGCGAAC
CCGGCGTGGGCAAGACCGCGGTGGTGGAAGGGCTGGCGTTGCGCATCGTCAATGGCGACGTGCCCGAGTT
CCTGCGCGATACGCGCCTGCTGGGCCTAGACCTGGGCCTGCTCGAGGCGGGCGCCAGCGTCAAGGGCGAG
TTCGAGAACCGGTTGCGCGGCGTCATCGATGAAATCAAGGGCTCGGTCAAGCCGATCATCCTGTTCATCG
ACGAAGCGCACATGCTGATCGGCGCCGGCGGCCAGAGCGGCGGCTCGGACGCCGCCAACCTGCTCAAGCC
GGCCCTGGCGCGCGGCGAGCTGCGCACCGTGGCGGCTACCACCTGGTCCGAGTACAAGAAGTATTTCGAG
AAAGACCCTGCCCTGGCGCGCCGGTTCCAGCTGGTGAAGCTGGACGAGCCCGACGTGCACACGGCGGTGC
AGATCCTGCGCGGCCTGAAAGACCGCTACGAGGCCGCGCACGGCGTCACGGTGCGCGACGATGCCATCGT
GGCCGCCGCTGAATTGTCGGACCGCTACATCACGGGACGCCTGCTGCCAGACAAGGCCGTGGATCTGCTG
GACACGGCGGCCGCGCGCGTGCGCATCGGCCTGGGCGTGAAGCCGGCCGAGCTGGAAAGCCTGGAAAGCC
GCCTGGCCGGCCTGGAGCGTGAGCGCGTGGCATTGGCGCGCGACGTGCAATTCCAGCCGGGAACCTACAG
CGAGCGGCTGGGCGAGATCGAGTCCGAACGCGCCAGCCTGCAGGCGCAGCACGCCGAGCTGGAGGCGCGC
TGGAAAACCGAGAAAGAAGCGGCCGAAGCCGTGCTGGCGCTGCGGCGCCAGTTGGGCCAGGCGCAGAATG
TGCCCGCCGTGCCCACAGCCCAGGCGCCTGACGGCAGCACGCCGGAGCCCACGGCCGAGGCCGCTGCCGA
ACCTGCCCGGGAGCCGGCCACCGATGTGTCTGCCGATACGTCCACGGACACGGTCACCGATACGGTTACT
GATACGTCCGCGCAAGCCGCGGCGTCGCCGCAAGCCCTGGCGGCTCAATTGGAAGAAGCCCGCAACAAGC
TGAAGAACCTGCAGGCGGGTTCGCCCCTCGTGTTCATTGAAACCGACCCGGACGCCGTGGCGCGCGTGGT
GTCGGACTGGACCGGCGTGCCTCTGGGGAAGATGCAGCGGGATGCCGTCAGCAGCGTGCTGGCGTTGGCC
GACCGCATCAAAGAACGCATACGCGGCCAGGACCACGCGGTGGACCAGATCGCGGCCACGGTCAAGGCCG
CGCAATCGGGCCTGCGGGACCCGCAGCAGCCCATGGGGGTGTTCCTGTTGGTAGGCCCCTCGGGCGTGGG
CAAGACGGAAACCGGCTTGGCGGTGGCCGACCAGTTGTTCGGCGGCGAGCATGCGCTGGTGTCGGTCAAC
ATGAGCGAATTTCAGGAAAAGCACACGGTCAGCCGCCTGGTGGGTTCGCCGCCGGGGTATGTCGGCTATG
GCGAAGGCGGCGTGCTGACCGAGGCCGTGCGCAAACGGCCCTATTCCGTGGTGCTGCTCGACGAGGTCGA
GAAGGCCCATCTGGACGTCGTGAACCTGTTCTATCAAGTGTTCGACAAGGGCACGCTGGCCGACGGCGAA
GGCCGCGTCATCGACTTCAGCAATACCGTGGTGTTCCTGACCAGCAATCTGGCCACCGAGGAAATCACCC
GGCTGGCCCGCGACGGCCGACCTGATGTCGAAGCCTTGACGACCGCCATTCACCCCGTGCTGGCCAAGCA
TTTCAAGCCAGCGCTGCTGGCGCGCATGACGGTCGTGCCCTACTACACCCTGCCGCCTTCCGAGCTGGCC
GGCATTGCCGAGCTCAAGCTGAACAAGCTGGCCAGCCGGCTGCTCGCGGCCAACCGCATACAACTGAGCT
TCGACGATGCCGTGCGCGACACCATCGCCGCGCGCTGCACCGAAGTGGATAGCGGCGCCCGCAACATCGA
TTTCATTCTGCGCAAGAGCCTGATGCCCTTGCTGTCGGATACGGTGCTGTCGGCGCTGGCGGATGGCCGC
GCCCTGAGCGCCATCCGCGTGGCGCCGGACGATAACGGCGGCTGGACCCTGACGACGACGGAGGCTTGA