SecReT6
Protein ID: 163856765
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2453
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2572689..2575157 [+]
Producthypothetical protein
NoteTssI
UniProt IDA9IN69
KEGG IDbpt:Bpet2453
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.20E-41, Aligned region: 32..348
Phage_base_V [PF04717], Evalue: 4.20E-15, Aligned region: 416..499
T6SS_Vgr [PF13296], Evalue: 0.00023, Aligned region: 543..590
Protein Sequence: 822 a.a.     [Download]
>gi|163856765|ref|YP_001631063.1| unnamed protein product [Bordetella petrii DSM 12804]
MTDAAYDYRLECPALRNLAPGQAIHVTHWRGTEAVSRLYRLEVTVAVRKADLPLEQLLNQPATLLARKPD
GALLRWHGIVTQGAQRGRDETYDYYQIVLEPRLARLRTLRWSDIYLNQQLDDIIRQLLRLAGLDEPYSSP
GAPYDYRIAASQLATTRTPFTCQFEESCLDFLMRKLEYYGVYFWFEQGEQQESVVFANSVEQQPTDLDSV
VYYPNGVIDPDATEVAVTRLNRLVSLRPGTVTLHDSNDWGNTALSLVSTASAPGPVVAFGEVHDMSSHFE
SLSDGDTIGGETLATWRSQELACERLRIEGEARTPGVCAGRLIEASEYLRGADPAQYYVIEVTHEGAQTL
ETAPETDAPAYLARFVALPRWLDSGASDQLPLQFRPARVTPVPVVTHMVNGFIDIDTPNQPKQYAQPDED
GRYKVRLTFARQRYGGNQNSAWLRMATPYAGGSSASGLHNAGMHFPLREGTEVLITFLNGNPDRPVIIAA
LPNVEAPSVVTAANPGDHLIQTPSGNVIAMRDAARQTTQDESQDSSGDYSVNNKSAILLSTTTENTSLNL
GATNDPSLADGFNLTTDDNGNIHAGTSMVIEVPGHLRMSAGSSGWAGLVSMQLPNMPTGVTIGSNAGLVV
QNFMGVKMETVEAITLGNFLGGKISATEAIDFSVTMGGRIGVKWAGEKDINLATKKYLAPQFRSTYGVVN
AIVNEWKGVAVQKEETAVNYSVSTIASHKVTTKGFYKVSAVTSTLAISTESISMATPVFSVGATGDATIT
GSSIEVTADMDLSLTGGANATISAIGVRMVSESDIYCNAPAITIGGGTVLVG
 
Nucleotide Sequence: 2469 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2572689-2575157 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACGGATGCCGCCTATGACTATCGCCTCGAGTGCCCGGCGCTGCGAAATCTGGCGCCCGGCCAGGCTA
TTCACGTCACGCACTGGCGAGGGACGGAGGCGGTTTCGCGGCTTTATCGTCTTGAGGTGACGGTTGCGGT
CCGCAAGGCGGATCTGCCCCTGGAGCAGCTGCTGAACCAGCCGGCCACGCTGTTGGCCCGCAAACCGGAT
GGGGCGTTGCTGCGCTGGCACGGCATCGTCACGCAGGGCGCGCAACGAGGCCGCGACGAGACTTACGACT
ACTACCAGATCGTGCTGGAGCCGCGCCTGGCGCGGCTGCGCACCCTGCGATGGTCGGACATCTACCTGAA
CCAGCAGCTCGACGACATTATCCGGCAACTGCTGCGCCTGGCTGGGCTGGACGAACCCTACAGCAGCCCG
GGAGCGCCGTACGACTACCGTATCGCGGCCAGCCAGTTGGCAACGACGCGCACGCCATTCACCTGCCAGT
TCGAGGAAAGCTGCCTGGATTTCCTGATGCGCAAATTGGAGTACTACGGTGTGTACTTCTGGTTTGAACA
GGGCGAACAACAAGAGTCTGTCGTATTCGCCAACAGCGTGGAGCAGCAACCCACCGACCTGGACAGCGTG
GTTTATTACCCCAACGGCGTGATCGATCCCGACGCCACCGAGGTCGCGGTCACGCGCCTGAACCGGCTTG
TCAGTTTACGGCCCGGCACAGTCACGCTGCACGACTCGAACGACTGGGGCAACACGGCGCTGTCGCTGGT
CAGTACGGCAAGCGCGCCTGGCCCCGTTGTGGCATTTGGCGAAGTGCATGACATGAGCAGCCATTTCGAG
AGCCTGAGTGATGGCGACACCATCGGCGGCGAAACACTGGCGACCTGGCGCAGCCAGGAACTGGCTTGTG
AGCGCCTGCGCATCGAAGGCGAGGCGCGCACCCCGGGTGTGTGCGCCGGCCGGTTGATCGAGGCCTCGGA
GTACCTGCGCGGCGCCGACCCTGCCCAGTATTACGTGATTGAAGTCACGCACGAGGGCGCGCAGACCCTG
GAGACGGCACCGGAAACGGATGCCCCCGCCTACTTGGCCCGTTTCGTGGCCCTGCCGCGCTGGCTGGATT
CCGGCGCGTCGGACCAGCTTCCCCTGCAGTTCCGCCCTGCCCGCGTGACGCCGGTGCCGGTGGTGACGCA
CATGGTCAATGGGTTTATCGATATCGACACCCCCAATCAGCCGAAACAATATGCCCAGCCGGATGAAGAC
GGCCGCTACAAAGTGCGGCTGACGTTTGCCCGGCAGCGCTACGGCGGCAACCAGAACTCTGCCTGGCTGC
GCATGGCCACCCCCTACGCGGGCGGCAGCTCGGCCTCCGGCCTGCACAATGCGGGAATGCACTTTCCGCT
GCGGGAAGGCACCGAGGTGCTGATCACTTTCCTGAACGGCAATCCCGACCGGCCGGTGATCATCGCCGCC
CTGCCCAACGTGGAGGCCCCCAGTGTGGTCACAGCGGCGAACCCGGGTGACCATTTGATCCAGACCCCGT
CAGGCAATGTGATCGCTATGCGGGACGCCGCCCGGCAGACCACGCAAGACGAGTCCCAGGACAGCTCCGG
GGACTACAGCGTCAACAACAAATCGGCCATCTTGTTGAGCACGACCACAGAGAATACGTCGCTGAACCTG
GGCGCCACCAATGATCCCTCTTTGGCGGACGGCTTCAACCTGACCACCGACGACAACGGCAACATCCACG
CGGGCACCAGCATGGTGATCGAGGTGCCGGGCCACCTGCGCATGTCGGCGGGCAGTTCGGGCTGGGCGGG
CCTGGTCAGCATGCAGTTGCCCAATATGCCTACCGGCGTGACGATCGGCAGCAACGCGGGCCTGGTCGTC
CAGAATTTCATGGGCGTGAAGATGGAGACCGTGGAAGCGATAACGCTGGGCAACTTTTTGGGCGGCAAGA
TCAGCGCCACGGAAGCAATAGATTTCTCGGTCACGATGGGCGGCAGGATAGGCGTGAAATGGGCCGGGGA
AAAGGACATCAACCTGGCCACCAAAAAATATCTCGCGCCTCAGTTCAGGAGCACCTACGGGGTCGTGAAT
GCGATTGTCAACGAATGGAAAGGCGTGGCCGTACAAAAAGAAGAGACGGCCGTGAATTATTCGGTGAGCA
CTATCGCGAGCCACAAGGTGACTACCAAGGGCTTTTACAAGGTGAGCGCCGTGACCAGCACGTTGGCGAT
CAGCACCGAGTCGATCTCCATGGCGACGCCAGTCTTCAGCGTGGGCGCTACTGGGGACGCGACGATCACG
GGCTCGTCCATCGAAGTCACCGCCGATATGGACCTGAGCCTGACGGGCGGCGCCAATGCGACGATCTCCG
CCATCGGCGTACGCATGGTGTCGGAAAGCGATATCTACTGTAACGCCCCGGCCATCACCATTGGCGGCGG
CACCGTCCTCGTAGGCTGA