SecReT6
Protein ID: 163856770
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2458
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2579860..2580588 [+]
Productlipoprotein
NoteTssJ
UniProt IDA9IN78
KEGG IDbpt:Bpet2458
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.80E-22, Aligned region: 29..191
Protein Sequence: 242 a.a.     [Download]
>gi|163856770|ref|YP_001631068.1| unnamed protein product [Bordetella petrii DSM 12804]
MTAMTILRHPLPRHRLLRRLLPAALCIGVLASCSSLNSMMGGSSEQDALKALKWTYAADGVQIALMADPH
LNQSTDQPHTLALTVVQMADPNAFTAATANSAKLTTLLLADSPPPGMLALNRVFVSPGEQRTITLARVEK
AQYVGLAAGYYHLDPARSARLYRIGVEVNSSGIIVTTRQAAPEPLKIDLRLGASGIQESPGAGAPPVTLT
KPKAGPVPPPAPAPAPAPAPAPAPAPAPAQQP
 
Nucleotide Sequence: 729 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2579860-2580588 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACCGCCATGACGATCTTGCGCCACCCGCTTCCGCGCCACCGGTTGTTGCGCCGCCTGCTGCCCGCGG
CGCTGTGCATCGGTGTCCTGGCATCGTGCAGCTCCCTGAACAGCATGATGGGAGGTTCGTCCGAGCAGGA
TGCGCTGAAAGCCCTGAAATGGACTTATGCCGCCGATGGCGTGCAGATTGCCTTGATGGCCGATCCGCAC
CTGAACCAATCGACCGACCAGCCCCACACCCTGGCGCTGACGGTCGTTCAGATGGCCGACCCCAATGCCT
TCACGGCCGCCACCGCGAACTCCGCCAAGCTGACCACGCTGCTGCTGGCCGACAGCCCGCCGCCCGGCAT
GCTGGCATTGAATCGCGTGTTCGTGTCGCCGGGCGAGCAGCGCACCATCACCCTTGCGCGCGTCGAGAAA
GCCCAGTACGTGGGCCTGGCCGCGGGCTACTACCACCTGGACCCGGCCCGTAGCGCCCGCCTGTACCGCA
TCGGCGTGGAAGTGAATTCGTCCGGCATCATCGTCACCACCCGCCAAGCCGCGCCTGAGCCTCTGAAGAT
CGATTTGCGGCTAGGCGCCAGCGGCATCCAGGAATCTCCGGGCGCAGGCGCTCCGCCCGTGACGCTGACC
AAGCCCAAGGCGGGGCCTGTGCCTCCGCCCGCCCCGGCCCCTGCCCCGGCCCCGGCCCCTGCCCCGGCCC
CTGCCCCGGCCCCGGCCCAACAACCTTGA