SecReT6
Protein ID: 163856771
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2459
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2580613..2582007 [+]
Producthypothetical protein
NoteTssK
UniProt IDA9IN81
KEGG IDbpt:Bpet2459
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-93, Aligned region: 21..462
Protein Sequence: 464 a.a.     [Download]
>gi|163856771|ref|YP_001631069.1| unnamed protein product [Bordetella petrii DSM 12804]
MTQPLNQPLFWHQGLFLQPHHFQYQDAWTARNLARQLDLIMPWGWGFGALQIDDTALAARHLVIEQLTLR
WPDGTLTEAPGNARIESVRFELADFSQGPRTLYVGLRRHVEGQPNVQKFENLDDAGQANTRLAVPADPQQ
VPDRYTPGPTGRVTLMTYVLRLFWDDELDHLGDYDLMPVAQLEQDGEVVRMMPRFVPPCLNLAASPQLQQ
MLRELRDEVIGRARQLEVFKQPVASRSDDAQFSPVLALSVLNRYGPLITHLAESLQTHPWTVYGVLRQLA
GELSTFSEYCDLLGETRDNQSLLSPYKHTDIGSAYAAVTELIRRLLNEITVGPEMMVHFEQDSMASALYQ
AEMPASFFGPRHRYYLMARSSAADPKELSELVALEAKLGIPDLIETLVTRSLPGIEMLPLQTLPLGMPRR
AGAAYFRLESLSDSWDDVVRDGRLAFFMPDAPADLRLELIVIKG
 
Nucleotide Sequence: 1395 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2580613-2582007 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACACAGCCACTTAACCAACCACTGTTCTGGCACCAGGGCCTGTTCCTGCAGCCGCACCATTTCCAGT
ACCAGGACGCCTGGACCGCGCGCAACCTTGCGCGGCAACTGGACCTGATCATGCCGTGGGGATGGGGTTT
CGGCGCGCTGCAGATCGACGACACCGCGCTAGCGGCGCGCCATCTGGTGATTGAACAGCTGACGCTGCGA
TGGCCCGACGGCACGCTGACCGAGGCGCCCGGCAATGCCCGCATCGAATCCGTGCGCTTCGAGCTGGCCG
ATTTTTCCCAGGGCCCGCGCACGCTGTATGTGGGGTTGCGCCGGCATGTCGAAGGGCAGCCCAATGTGCA
GAAGTTCGAAAACCTGGACGATGCCGGCCAGGCCAACACGCGCCTGGCGGTGCCCGCCGACCCGCAACAA
GTGCCGGACCGCTATACGCCGGGCCCTACTGGCCGGGTCACCTTGATGACTTATGTGTTGCGCCTGTTCT
GGGACGACGAGCTGGACCATCTGGGCGACTACGACCTGATGCCGGTCGCTCAACTGGAACAGGATGGCGA
GGTAGTGCGCATGATGCCGCGCTTCGTTCCGCCTTGCTTGAACCTGGCGGCCTCGCCGCAGTTGCAGCAG
ATGCTGCGCGAGCTGCGCGACGAGGTGATCGGCCGGGCACGCCAGCTGGAGGTGTTCAAGCAGCCGGTGG
CCAGCCGCTCTGACGATGCGCAATTTTCGCCTGTGCTGGCGCTGTCGGTGCTCAATCGCTACGGGCCGCT
GATCACGCACCTGGCGGAATCGCTGCAGACGCATCCCTGGACGGTATATGGGGTGTTGCGGCAACTGGCC
GGCGAGCTGAGCACATTCTCGGAATACTGCGACCTGCTGGGCGAAACGCGCGACAACCAGTCGTTATTGT
CCCCGTACAAACACACCGACATCGGCTCGGCCTATGCCGCCGTGACCGAACTGATTCGACGGTTGCTGAA
CGAAATCACCGTCGGGCCTGAAATGATGGTGCATTTCGAGCAGGACAGCATGGCCTCGGCCTTGTACCAG
GCCGAGATGCCGGCCAGCTTCTTCGGCCCGCGGCATCGGTATTACCTCATGGCGCGCAGCTCGGCCGCGG
ACCCCAAGGAACTGAGCGAACTCGTCGCGCTGGAAGCCAAGCTGGGCATTCCGGACCTGATCGAGACGCT
GGTGACGCGCTCGTTGCCGGGGATCGAGATGCTGCCGCTGCAGACCCTGCCGCTGGGCATGCCGCGCCGT
GCGGGCGCGGCGTATTTCCGCCTGGAAAGCCTGTCGGACAGCTGGGACGACGTAGTACGCGACGGACGGC
TGGCCTTCTTCATGCCGGACGCGCCTGCCGACCTGCGGTTGGAACTCATTGTGATCAAAGGATAA