SecReT6
Protein ID: 163856772
SecReT6 ID250
T6SS typei1
Gene symbol-
Locus tagBpet2460
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]2582011..2582682 [+]
Producthypothetical protein
NoteTssL
UniProt IDA9IN83
KEGG IDbpt:Bpet2460
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-37, Aligned region: 15..208
Protein Sequence: 223 a.a.     [Download]
>gi|163856772|ref|YP_001631070.1| unnamed protein product [Bordetella petrii DSM 12804]
MRLSNFWIPIIDSARVATTQADQDAASLSAQLKATLDATAARAQDAGFSPDDVQLALFAVVAWIDELAMS
REWPGADSWRLAPLQRHYFGTTRAGVVFFEKLESLPDEAVEVREVYALVLLAGFHGRYTHRPAGELAEYR
RALLERVSQERQMDPLSTEQPLFPLSGAGARRPVRRHRGLAPSLASLLLIVLPLCVLLGLYLFLDYRLAH
AAAQLIAPLTGRL
 
Nucleotide Sequence: 672 bp     [Download]
>gi|163854304|ref|NC_010170.1|:2582011-2582682 Bordetella petrii DSM 12804 chromosome, complete genome
GTGCGCCTGAGCAACTTCTGGATTCCCATCATCGATTCGGCCCGCGTGGCGACGACGCAGGCCGACCAGG
ATGCGGCCTCGCTGTCGGCGCAGTTGAAGGCGACGCTGGACGCCACCGCCGCACGCGCGCAGGACGCCGG
CTTTTCTCCAGACGATGTGCAACTGGCGCTGTTCGCGGTGGTGGCCTGGATCGATGAACTGGCCATGTCG
CGCGAATGGCCGGGCGCCGATTCTTGGCGGTTGGCGCCGCTGCAGCGCCACTATTTCGGCACGACCCGCG
CGGGCGTGGTGTTCTTCGAAAAGCTGGAGTCCCTGCCGGACGAAGCGGTCGAGGTGCGGGAAGTGTATGC
CCTGGTGCTGCTGGCTGGCTTTCACGGGCGCTACACGCATCGGCCAGCGGGTGAGCTTGCCGAATACCGC
CGCGCCTTGCTGGAACGTGTGTCCCAGGAACGCCAGATGGACCCGCTGAGCACGGAACAGCCCTTGTTTC
CGCTGTCGGGCGCGGGCGCCAGGCGGCCGGTGCGCCGCCATCGTGGCCTGGCGCCATCGCTGGCCAGTCT
GCTGCTGATCGTGCTGCCCCTGTGCGTGCTGCTGGGCCTTTATCTGTTCCTGGACTATCGCCTGGCGCAT
GCCGCCGCGCAGTTGATTGCACCACTGACAGGCCGTCTTTGA