SecReT6
Protein ID: 163858422
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4104
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4341819..4343153 [-]
Producthypothetical protein
NoteTssK
UniProt IDA9I7V6
KEGG IDbpt:Bpet4104
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 9.10E-159, Aligned region: 19..443
Protein Sequence: 444 a.a.     [Download]
>gi|163858422|ref|YP_001632720.1| unnamed protein product [Bordetella petrii DSM 12804]
MAEKSKVVWSEGMFLRPQHFQQFERYLEGLLQQRAASLHGFFWGFSHLALDRDALAVGKLVLTQASGVLP
DGTPFEFSHPDDAPQALEVPEHAQDVRVMLALPRIRPGATDVQYEDEADSLARYLVQEAEVEDSGSVGLE
PALLQLGRLRLRLMLETDLGDEWLGLGVVRVIERRADNRVVLDERYIPPWLAAGAHPLLLGFVQELYGLL
NARSEALAMRLSQPGRGGVSEVSDFMLLETVNRYIGALWHARQAEWLHPERLFHDWLMLACDLATYTAAS
RRPEVLPEYRHDDLQTTFEMLMNELRRSLSAVLEQHALQIPLQDRGQGVRVAQIPDLELLRTAGFVLAVH
ADMPSDTVRSRFPAQVKIGPVERIRDLVHLQLPGVTVRALPVAPRQIPYSAGHVYFELDKGGDFWKQLER
TGALALHLAGEFPGLSMEFWALRD
 
Nucleotide Sequence: 1335 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4343153-4341819 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCAGAGAAGAGCAAAGTCGTATGGTCCGAGGGGATGTTCCTGCGGCCTCAGCATTTCCAGCAGTTCG
AGCGCTACCTGGAAGGGTTGCTGCAGCAGCGCGCCGCTTCGCTGCACGGGTTTTTCTGGGGGTTCAGCCA
CCTCGCCCTGGACCGTGACGCGCTGGCCGTGGGCAAGCTGGTGCTCACGCAGGCCAGCGGCGTGCTGCCC
GACGGCACGCCGTTTGAATTTTCACACCCCGATGACGCGCCGCAGGCGCTGGAAGTGCCCGAGCACGCCC
AGGACGTGCGCGTCATGCTCGCGCTGCCGCGCATTCGGCCGGGCGCCACCGACGTGCAGTATGAAGACGA
GGCCGATTCGCTGGCGCGCTACCTGGTGCAGGAAGCCGAGGTCGAAGATTCCGGCTCGGTCGGGCTGGAG
CCGGCGCTGTTGCAGCTGGGCCGGCTGCGGCTGCGCCTGATGCTCGAAACCGACCTGGGCGACGAATGGC
TGGGCCTGGGCGTGGTCCGGGTGATCGAACGCCGCGCGGACAACCGCGTGGTGCTGGACGAACGCTACAT
CCCGCCGTGGCTGGCGGCTGGCGCGCATCCGTTGCTGCTGGGTTTCGTGCAGGAGCTGTACGGCCTGCTG
AACGCGCGCAGCGAGGCCCTGGCCATGCGCTTGTCGCAACCCGGGCGCGGCGGCGTGTCCGAGGTGTCCG
ACTTCATGCTGCTGGAAACCGTCAACCGCTACATCGGCGCGCTATGGCACGCGCGCCAGGCCGAGTGGCT
GCACCCCGAGCGCCTGTTCCACGACTGGCTGATGCTGGCCTGCGACCTTGCCACGTACACGGCTGCGTCG
CGCCGCCCCGAGGTGCTGCCCGAATACCGGCACGACGATCTGCAGACCACGTTCGAGATGTTGATGAACG
AGCTGCGCCGCTCGCTGTCGGCGGTGCTGGAGCAGCATGCCCTGCAGATCCCGCTGCAGGACCGCGGCCA
GGGCGTGCGCGTGGCGCAGATTCCCGACCTGGAACTGCTGCGCACGGCGGGCTTCGTGCTGGCGGTGCAC
GCCGACATGCCGTCGGACACGGTGCGCTCGCGCTTCCCCGCGCAGGTCAAGATAGGCCCCGTCGAGCGCA
TTCGCGACCTGGTGCACCTGCAGCTGCCCGGCGTGACGGTGCGCGCGCTGCCGGTGGCGCCGCGGCAGAT
TCCGTACAGCGCGGGCCACGTGTATTTCGAATTGGACAAGGGTGGGGATTTCTGGAAGCAGCTGGAGCGC
ACGGGCGCGCTGGCGCTGCACCTGGCCGGCGAATTCCCCGGCTTGTCCATGGAATTCTGGGCGTTGCGCG
ACTAG