SecReT6
Protein ID: 163858423
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4105
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4343212..4343901 [-]
Productlipoprotein
NoteTssJ
UniProt IDA9I7V9
KEGG IDbpt:Bpet4105
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.90E-41, Aligned region: 69..216
Protein Sequence: 229 a.a.     [Download]
>gi|163858423|ref|YP_001632721.1| unnamed protein product [Bordetella petrii DSM 12804]
MISGIYPSAKNPGGFRNSSNYFCICTTVSCFSLVIHAFSIIPGGIPRIMVFRKTAISIVRGLCASLAALV
LLAGCSSTARQVPVPYAIELTADPQVNPDVHGRPSPVQITVYELTSSSAFESRDFFSLQSDPQAALGKEL
LNTDQAILRPGETKTLKYSGSAQARVVGIVAAYRDLEKSHWRLVVPLPEAQNTNIYKVWQFSPNEEMIKV
SVKDNSLAVVDRERSWWPF
 
Nucleotide Sequence: 690 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4343901-4343212 Bordetella petrii DSM 12804 chromosome, complete genome
ATGATTTCCGGAATATATCCAAGCGCGAAAAACCCAGGGGGGTTCCGTAACAGTAGTAACTATTTCTGTA
TTTGCACGACAGTTTCTTGTTTTTCCCTTGTCATACACGCTTTCTCCATAATCCCAGGGGGCATTCCGCG
AATTATGGTGTTCCGCAAGACCGCTATTTCTATTGTGAGAGGGCTCTGCGCGAGCCTTGCTGCCCTGGTG
CTGCTGGCCGGGTGTTCTTCCACCGCCAGGCAGGTGCCTGTTCCCTATGCCATCGAGCTGACCGCTGATC
CGCAGGTGAATCCGGACGTGCACGGGCGCCCGTCGCCAGTGCAGATCACGGTTTATGAACTGACCTCGTC
CAGCGCTTTCGAGTCGCGCGATTTCTTTTCGCTGCAATCCGATCCGCAGGCCGCGCTAGGCAAAGAACTG
CTGAACACCGACCAGGCCATCCTGCGGCCGGGCGAAACCAAGACCCTGAAGTATTCCGGCAGCGCCCAAG
CCCGCGTCGTGGGCATTGTGGCCGCCTACCGCGACCTCGAGAAAAGCCACTGGCGGCTGGTCGTGCCGCT
GCCCGAAGCGCAGAACACCAATATATATAAGGTATGGCAGTTCTCGCCCAACGAAGAAATGATCAAGGTG
TCGGTCAAGGACAACAGCCTGGCCGTGGTCGACCGGGAGCGTTCCTGGTGGCCGTTCTAG