SecReT6
Protein ID: 163858424
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4106
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4343978..4345147 [+]
Producthypothetical protein
NoteFha
UniProt IDA9I7W2
KEGG IDbpt:Bpet4106
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.60E-08, Aligned region: 27..94
Protein Sequence: 389 a.a.     [Download]
>gi|163858424|ref|YP_001632722.1| unnamed protein product [Bordetella petrii DSM 12804]
MRLTVQPRSDDPGSAPLSAVFQAPGGTLGRSADNHLVLPDNDRGICRIQAALRISDGACYLVNLSGMSRV
SINGRAITRDQEVPLAPGDELAIGPYTLKAEDPDAPMATAPAAMAAAAATAAASAQAAPPEPDPLLESPL
LEGADLAPPDTHTVHPASPPSYTAPEISKTPDTYIEPTPATPAQASDTLPAPPAPDTRETADTAPEPAQP
LPEPPAPFPSAPARFDAPFADLDPPLAAEPQAPQSDPADVFSDLFGPGTLPVGSVPDVSAHPFDLESAQA
RNPEDPLSQLPRGDANVRGPLRDPLDMLGSPDADSADSVFSDQTPSTLPSHDPLDPHRSDPVTDTLTPRP
RDDSAHAARDHLREYGGYMRPARARQPEEPDAAGKPPRK
 
Nucleotide Sequence: 1170 bp     [Download]
>gi|163854304|ref|NC_010170.1|:4343978-4345147 Bordetella petrii DSM 12804 chromosome, complete genome
ATGAGACTCACCGTACAGCCACGTAGCGACGACCCGGGCTCCGCCCCGCTGTCGGCGGTATTCCAGGCTC
CCGGCGGCACGCTGGGACGCTCGGCCGACAACCACCTGGTCCTGCCCGACAACGACCGCGGCATCTGCCG
CATCCAGGCCGCGTTGCGCATCAGCGACGGCGCCTGCTATCTGGTCAACCTCAGCGGCATGAGCCGCGTC
AGCATCAACGGCCGCGCCATCACGCGCGACCAGGAAGTGCCGCTGGCGCCGGGCGACGAACTCGCCATCG
GCCCATACACGCTCAAGGCCGAAGACCCCGACGCGCCCATGGCCACTGCCCCGGCAGCCATGGCTGCGGC
CGCCGCCACCGCCGCGGCATCCGCGCAGGCCGCGCCGCCCGAGCCCGATCCCCTGCTCGAAAGTCCGTTG
CTCGAAGGCGCCGATCTCGCGCCCCCCGATACGCACACCGTCCATCCAGCCTCCCCGCCCTCCTATACGG
CGCCGGAAATTTCCAAGACGCCTGACACCTATATAGAACCCACGCCCGCGACACCCGCCCAGGCGTCCGA
CACGCTGCCGGCCCCGCCTGCGCCAGACACCCGCGAGACCGCGGACACTGCGCCCGAACCGGCGCAACCG
CTGCCCGAGCCCCCCGCGCCATTTCCCTCGGCCCCGGCGCGATTTGACGCGCCGTTCGCCGACCTGGATC
CACCCCTGGCCGCCGAGCCCCAGGCACCGCAGTCCGACCCGGCCGATGTATTCAGCGACCTGTTCGGCCC
CGGCACCCTGCCGGTAGGCAGCGTGCCCGACGTCTCGGCGCACCCGTTCGACCTGGAATCCGCCCAGGCG
CGCAACCCGGAAGACCCGCTAAGCCAATTGCCGCGCGGCGACGCCAATGTGCGCGGCCCCCTGCGCGACC
CGCTGGACATGCTGGGCAGTCCCGACGCCGATTCCGCCGACAGCGTCTTCTCGGACCAGACTCCCTCGAC
GCTGCCCTCGCACGACCCGCTGGACCCCCACCGCTCGGATCCGGTCACCGACACCCTCACCCCGCGCCCG
CGCGATGACAGCGCCCACGCCGCGCGCGACCATCTGCGCGAATACGGCGGCTACATGCGGCCCGCGCGCG
CACGCCAGCCAGAAGAGCCCGACGCCGCCGGCAAGCCGCCGCGCAAATAG