SecReT6
Protein ID: 163858425
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4107
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4345165..4347864 [-]
ProductATPase
NoteTssH
UniProt IDA9I7W4
KEGG IDbpt:Bpet4107
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.30E-39, Aligned region: 222..257
AAA_2 [PF07724], Evalue: 8.30E-39, Aligned region: 631..797
AAA [PF00004], Evalue: 4.30E-20, Aligned region: 224..357
AAA [PF00004], Evalue: 4.30E-20, Aligned region: 637..721
ClpB_D2-small [PF10431], Evalue: 3.90E-16, Aligned region: 205..219
ClpB_D2-small [PF10431], Evalue: 3.90E-16, Aligned region: 804..882
AAA_5 [PF07728], Evalue: 6.30E-12, Aligned region: 224..244
AAA_5 [PF07728], Evalue: 6.30E-12, Aligned region: 349..383
AAA_5 [PF07728], Evalue: 6.30E-12, Aligned region: 636..754
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 201..243
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 269..303
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 627..679
AAA_16 [PF13191], Evalue: 1.50E-08, Aligned region: 778..828
AAA_22 [PF13401], Evalue: 5.00E-07, Aligned region: 224..304
AAA_22 [PF13401], Evalue: 5.00E-07, Aligned region: 537..602
AAA_22 [PF13401], Evalue: 5.00E-07, Aligned region: 635..658
AAA_22 [PF13401], Evalue: 5.00E-07, Aligned region: 698..719
Sigma54_activat [PF00158], Evalue: 5.10E-07, Aligned region: 218..239
Sigma54_activat [PF00158], Evalue: 5.10E-07, Aligned region: 635..749
AAA_19 [PF13245], Evalue: 3.50E-06, Aligned region: 222..247
AAA_19 [PF13245], Evalue: 3.50E-06, Aligned region: 634..659
Zeta_toxin [PF06414], Evalue: 7.80E-06, Aligned region: 123..149
Zeta_toxin [PF06414], Evalue: 7.80E-06, Aligned region: 223..245
Zeta_toxin [PF06414], Evalue: 7.80E-06, Aligned region: 468..504
Zeta_toxin [PF06414], Evalue: 7.80E-06, Aligned region: 626..676
AAA_17 [PF13207], Evalue: 2.30E-05, Aligned region: 225..266
AAA_17 [PF13207], Evalue: 2.30E-05, Aligned region: 635..672
NACHT [PF05729], Evalue: 3.00E-05, Aligned region: 224..259
NACHT [PF05729], Evalue: 3.00E-05, Aligned region: 636..664
IstB_IS21 [PF01695], Evalue: 7.00E-05, Aligned region: 208..243
IstB_IS21 [PF01695], Evalue: 7.00E-05, Aligned region: 636..656
AAA_18 [PF13238], Evalue: 0.00014, Aligned region: 224..247
AAA_18 [PF13238], Evalue: 0.00014, Aligned region: 637..665
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 282..304
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 341..390
AAA_14 [PF13173], Evalue: 0.00014, Aligned region: 635..753
AAA_25 [PF13481], Evalue: 0.00022, Aligned region: 207..248
AAA_25 [PF13481], Evalue: 0.00022, Aligned region: 279..314
AAA_25 [PF13481], Evalue: 0.00022, Aligned region: 469..519
AAA_25 [PF13481], Evalue: 0.00022, Aligned region: 632..662
AAA_25 [PF13481], Evalue: 0.00022, Aligned region: 831..878
AAA_29 [PF13555], Evalue: 0.00026, Aligned region: 216..241
AAA_29 [PF13555], Evalue: 0.00026, Aligned region: 634..661
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 224..245
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 273..304
TIP49 [PF06068], Evalue: 0.0013, Aligned region: 635..672
Arch_ATPase [PF01637], Evalue: 0.0027, Aligned region: 203..240
Arch_ATPase [PF01637], Evalue: 0.0027, Aligned region: 277..307
Arch_ATPase [PF01637], Evalue: 0.0027, Aligned region: 635..675
RuvB_N [PF05496], Evalue: 0.0049, Aligned region: 223..241
RuvB_N [PF05496], Evalue: 0.0049, Aligned region: 295..304
RuvB_N [PF05496], Evalue: 0.0049, Aligned region: 603..657
RuvB_N [PF05496], Evalue: 0.0049, Aligned region: 706..728
RNA_helicase [PF00910], Evalue: 0.0067, Aligned region: 225..245
RNA_helicase [PF00910], Evalue: 0.0067, Aligned region: 637..658
RNA_helicase [PF00910], Evalue: 0.0067, Aligned region: 735..755
Hpr_kinase_C [PF07475], Evalue: 0.0086, Aligned region: 224..236
Hpr_kinase_C [PF07475], Evalue: 0.0086, Aligned region: 633..655
DUF815 [PF05673], Evalue: 0.0095, Aligned region: 215..258
DUF815 [PF05673], Evalue: 0.0095, Aligned region: 385..401
DUF815 [PF05673], Evalue: 0.0095, Aligned region: 607..675
Protein Sequence: 899 a.a.     [Download]
>gi|163858425|ref|YP_001632723.1| unnamed protein product [Bordetella petrii DSM 12804]
MSDIGRLDLFGKLDPLLYQALEGATSFCKLRGNPYVELVHWIHQIVHTQDSDLHRIARRFDLDMGALQAD
LTAALDQLPRGAGSVSDLSEHIDHAVERAWVLGSLRYGAGRIRGGHLMAGLVKTYALRNVLLGMSDQFSR
IVPDVLLEQLDDIVRGSPEDATAQPAEAVAGGGAPAEGGSALAKYAVDLTARARAGEIDPVSGRDEEIRQ
IVDILMRRRQNNPLLAGEAGVGKTAVVEGLALRLASGDVPPPLREVSLYLLDIGLLQAGAGVKGEFEQRL
RGVIDEVQASPSPIVLFIDEIHTLVGAGGAAGTGDAANLLKPALARGQLRTIGATTWSEYKKYIEKDPAL
TRRFQVVQIHEPAEPRALGMLRGLAATLEAHHQVLLLDEAIEAAVSLSHRYIPARQLPDKAVALLDTACA
RVAVSQHAVPAALEDARRRIEALEIEQRIAAREARLGAGAEARVTQLAGELAQARAHETELAQRWESKRA
LAARVFELRRALDQDAAPAVETVEAAAAAEGEVGAREHPTAATPAQDPARLRAELAQAQEELAQRQGEAA
LIYPAVDAAAVASVVADWTGIPVGRMVRDEAQSVLRLADTLEQRVIGQRHGLEAIARRIQTSRARLTDPN
KPVGVFLLCGPSGVGKTETALALAEALYGGEQNLIAINMSEFQESHTVSTLKGAPPGYVGYGEGGVLTEA
VRRRPYSVVLLDEVEKAHADVHEIFFQVFDKGWMEDGEGRYIDFRNTIIILTSNVGTELIASLCRDPALM
PDADGLAAALREPLLKAFPAALLGRLVAVPYMPLSDEMLARIVDLQFDRVRQRLLDNHGIALTVSPEATA
LVVARCTEVESGGRMVDAILTNTVLPQISRELLTASMEGREVRAVALEAAEGDFRYRYE
 
Nucleotide Sequence: 2700 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4347864-4345165 Bordetella petrii DSM 12804 chromosome, complete genome
ATGTCCGACATCGGCCGCCTCGATCTTTTCGGCAAACTCGATCCGCTGCTGTACCAGGCGCTGGAAGGCG
CCACTTCGTTCTGCAAGCTGCGCGGCAATCCGTATGTCGAGCTGGTGCACTGGATACACCAGATCGTGCA
CACGCAAGACAGCGACCTGCACCGCATTGCTCGCCGCTTCGACCTCGACATGGGGGCGCTGCAGGCGGAC
CTGACCGCCGCGCTGGACCAACTGCCGCGCGGCGCGGGTTCGGTGTCCGATTTGTCGGAACACATCGACC
ATGCGGTCGAGCGCGCCTGGGTGCTGGGCTCGTTGCGCTATGGCGCCGGGCGCATCCGCGGCGGGCACTT
GATGGCCGGCCTGGTCAAGACGTATGCCCTGCGCAATGTGCTGCTGGGCATGTCCGACCAGTTCTCGCGC
ATTGTGCCCGATGTGCTGCTGGAACAGCTGGACGATATTGTGCGCGGGTCGCCCGAAGATGCCACGGCCC
AGCCGGCCGAGGCGGTGGCCGGCGGCGGCGCGCCCGCCGAGGGCGGCTCGGCGCTGGCCAAGTATGCCGT
GGACCTGACCGCCCGGGCGCGGGCTGGCGAGATCGACCCCGTGTCGGGACGAGACGAGGAAATCCGCCAG
ATCGTCGACATTCTGATGCGGCGCCGCCAGAACAATCCGCTGCTGGCCGGCGAAGCCGGCGTGGGCAAGA
CCGCGGTGGTGGAAGGCCTGGCCTTGCGCCTGGCCAGCGGCGACGTGCCGCCCCCTTTGCGCGAGGTGTC
GCTGTATCTGCTGGACATTGGCCTGCTGCAGGCAGGCGCTGGTGTGAAGGGCGAGTTCGAGCAGCGCCTG
CGTGGCGTGATCGATGAGGTGCAGGCCAGCCCCAGCCCCATCGTGCTGTTCATCGACGAAATCCACACCC
TGGTGGGGGCGGGCGGCGCGGCCGGCACGGGCGACGCCGCCAACTTGCTCAAGCCCGCGCTGGCGCGCGG
GCAGTTGCGCACCATCGGCGCCACCACATGGTCGGAGTATAAGAAATACATCGAGAAAGATCCCGCGCTG
ACGCGGCGCTTCCAGGTCGTGCAGATCCACGAGCCGGCCGAACCGCGCGCGTTGGGCATGCTGCGCGGCC
TGGCGGCCACGCTTGAGGCGCATCACCAGGTGTTGCTGCTGGATGAGGCCATCGAGGCAGCGGTGTCGTT
GTCGCATCGCTATATTCCCGCGCGGCAGTTGCCCGACAAGGCCGTGGCGCTGCTGGACACCGCCTGCGCG
CGCGTGGCGGTCAGCCAGCATGCGGTGCCGGCGGCGCTGGAAGACGCGCGCCGGCGTATCGAGGCGCTGG
AGATCGAGCAGCGCATTGCGGCGCGCGAAGCCCGCCTGGGAGCCGGCGCCGAAGCGCGCGTGACCCAGCT
GGCCGGCGAGCTGGCCCAGGCGCGCGCCCACGAAACCGAACTGGCGCAGCGCTGGGAGTCCAAGCGTGCG
CTGGCGGCGCGGGTATTCGAGCTGCGCCGGGCGCTGGACCAGGACGCGGCGCCGGCTGTCGAAACCGTGG
AAGCCGCCGCCGCCGCAGAGGGCGAGGTCGGGGCGCGAGAACACCCCACCGCCGCGACGCCCGCGCAGGA
TCCGGCCCGTTTGCGCGCTGAATTGGCGCAGGCGCAGGAGGAACTGGCCCAGCGCCAGGGCGAAGCCGCG
CTGATCTATCCCGCGGTGGACGCGGCCGCTGTGGCGTCGGTGGTCGCTGACTGGACGGGCATCCCGGTGG
GCCGCATGGTACGCGACGAGGCCCAGTCGGTGCTGCGACTGGCCGATACGCTGGAGCAGCGCGTGATCGG
GCAGCGCCACGGCCTGGAGGCCATTGCGCGGCGCATCCAGACCTCGCGCGCCCGGCTGACGGACCCGAAC
AAGCCCGTTGGCGTGTTTCTGCTGTGCGGTCCGAGCGGCGTGGGCAAGACCGAAACCGCGCTGGCGCTGG
CCGAGGCGCTATACGGCGGCGAGCAGAACCTGATCGCCATCAACATGAGCGAATTCCAGGAATCGCACAC
GGTGTCGACGCTGAAAGGCGCGCCGCCCGGATACGTCGGCTATGGCGAAGGCGGCGTGCTGACCGAGGCC
GTGCGGCGGCGGCCGTACAGCGTGGTGTTGCTCGACGAGGTCGAGAAGGCCCATGCCGACGTGCACGAGA
TCTTCTTCCAGGTGTTCGACAAGGGCTGGATGGAAGACGGCGAGGGCCGCTATATCGATTTTCGCAACAC
CATCATCATCCTGACATCGAACGTGGGCACCGAGCTGATCGCCAGCCTGTGCCGCGACCCGGCGCTGATG
CCCGATGCCGATGGCCTGGCGGCGGCGCTGCGCGAGCCCCTGCTGAAGGCGTTTCCGGCGGCCTTGCTGG
GGCGGCTGGTGGCAGTGCCTTATATGCCGCTGTCGGACGAGATGCTGGCGCGCATTGTGGATCTGCAGTT
CGACCGCGTGCGCCAGCGGCTGCTCGACAACCACGGCATCGCGCTTACTGTCAGCCCCGAGGCCACGGCG
CTGGTGGTGGCGCGATGCACGGAAGTGGAGTCCGGCGGCCGCATGGTCGATGCGATTCTGACCAATACGG
TGCTGCCGCAGATCAGCCGCGAGCTGCTGACCGCATCCATGGAAGGGCGCGAGGTGCGCGCGGTGGCGCT
GGAAGCCGCCGAAGGCGACTTCCGCTACCGGTACGAATAG