SecReT6
Protein ID: 163858428
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4110
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4348792..4349937 [-]
Producthypothetical protein
NoteTssG
UniProt IDA9I7X0
KEGG IDbpt:Bpet4110
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.20E-110, Aligned region: 45..345
Protein Sequence: 381 a.a.     [Download]
>gi|163858428|ref|YP_001632726.1| unnamed protein product [Bordetella petrii DSM 12804]
MASLATEPEQAAPDLGQARREPAVPPPPGAGASGLPPGFWRALEKEPYAHDLFNTLRWIDARAGARLPLG
RDTVARNEPVRLRQEPSMAFAPSTLAAARPARAGRPPELSIYSFGLFGPNGPLPLHLTEYARERMHHYGD
QTLSAFADIFHHRLILLFYRAWADAQSTVSLDRKEERFTRYVASLLHMGMPSLLRRDTVMDHAKFYMAGH
LVRQTRNPEGLKQILQSFFSVPVRIAEFVPQWIRLEPSQRLGLGSSLGLGRDTILGTAVRDAQHKFRIEL
GPLGRAEYASFLPGGRRARQLLHWVRDYIGVELAWDVRPVLKRQDVRGVALGAAQPLGLSSWLGKRRSEQ
GDARDLLLDYESRDRAARRAATPTQPQEVTA
 
Nucleotide Sequence: 1146 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4349937-4348792 Bordetella petrii DSM 12804 chromosome, complete genome
GTGGCCAGCCTGGCGACCGAACCGGAACAGGCCGCGCCCGACCTCGGGCAGGCGCGGCGGGAGCCCGCCG
TGCCGCCGCCGCCCGGCGCCGGGGCGTCCGGGCTGCCGCCCGGATTCTGGCGCGCGCTGGAGAAGGAGCC
CTACGCTCACGACCTGTTCAATACGCTGCGCTGGATCGACGCGCGCGCCGGCGCGCGCTTGCCGCTGGGC
CGCGATACCGTGGCTCGCAACGAACCGGTACGCTTGCGGCAAGAGCCGTCGATGGCCTTTGCGCCGTCGA
CCCTGGCGGCCGCGCGCCCGGCGCGGGCCGGACGGCCACCGGAGCTGTCGATCTACAGTTTCGGACTGTT
CGGGCCGAACGGCCCGTTGCCGCTGCATCTGACCGAGTACGCGCGCGAGCGCATGCACCATTACGGCGAC
CAGACGCTGTCGGCGTTCGCCGACATATTCCATCACCGCCTGATCCTGCTGTTCTACCGGGCCTGGGCCG
ACGCGCAGAGCACAGTCAGCCTGGACCGCAAGGAAGAGCGCTTTACCCGCTACGTGGCCAGCTTGCTGCA
CATGGGCATGCCGTCGCTGCTGCGCCGCGATACGGTAATGGACCACGCCAAGTTCTATATGGCCGGCCAC
CTGGTCCGGCAGACGCGCAACCCGGAGGGGCTGAAGCAGATTCTGCAGAGTTTTTTCTCGGTGCCGGTGC
GCATCGCGGAGTTCGTGCCGCAATGGATACGCCTGGAGCCGTCGCAACGGCTGGGCCTGGGAAGCAGCCT
GGGCCTGGGCAGGGACACCATTCTGGGCACGGCGGTGCGCGATGCCCAGCACAAGTTTCGCATCGAGCTC
GGCCCGCTGGGACGCGCCGAGTACGCCAGTTTTTTGCCGGGCGGGCGGCGCGCGCGCCAGTTGTTGCACT
GGGTGCGCGATTACATCGGCGTAGAGCTGGCGTGGGATGTGCGGCCGGTGCTCAAGCGGCAGGATGTGCG
GGGCGTGGCGCTGGGCGCGGCCCAGCCGCTGGGCCTGTCGTCTTGGCTAGGCAAGCGCCGGTCCGAGCAG
GGCGACGCGCGCGACCTGCTGCTGGACTACGAAAGCCGCGACCGCGCCGCGCGCCGGGCCGCAACCCCAA
CCCAACCACAGGAGGTGACCGCGTGA