SecReT6
Protein ID: 163858430
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4112
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4350645..4352549 [-]
Producthypothetical protein
NoteTssF
UniProt IDA9I7X4
KEGG IDbpt:Bpet4112
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-209, Aligned region: 5..633
Protein Sequence: 634 a.a.     [Download]
>gi|163858430|ref|YP_001632728.1| unnamed protein product [Bordetella petrii DSM 12804]
MDARLLDYYNRELVYMREMGAEFAQMYPKVAGRLGMHGTEVADPYVERLLEGFSFLTARIHLKMDAEFPR
FSQRLLEVVYPNYLAPTPAMAVVQFSPSMNEGTLARGFDLPRGTLLRGRVPRGEQTSCEFMTGHAVRLWP
LRVAEAEFTGPPPDLPLTRLGLGGRNGRVLSALRMRIEVCGGVRLEDMDLDQLVFHLAGQDLQMQRLLEI
IMGHTVAVLGHDSARPVTWINKLAPTSVRHEGFDDEQALLPADSRVFQGYRLLQEYFAFPRRYLFFSLND
LKRGLRTPALAGGERRETRSFDLTMLFSTAAPELEGAIAAEHLALHCAPVINLFPKRADRIAVTPRTNEY
HLVVDRTRPLDYEVFGVTRVVGHASAERPEQEFRSFYGTLGSDPDDYGAYYSLRREPRLLSDHAQRNGTR
TGYTGSEVFVSLVDRHEAPFSGQLRHLTLETLCTNRDLAMLLPLGTETDFTLRVSAPVGAVKVLHGPTRP
HTALAENAATWHLISHLGLNYLSLIDLDAEQGAQTLREMLHVYGNLADPVVRKHIGGVRHVQAEPMHHRL
PVPGPIVYGRGVRIGLQVDETAFSGISPYLFGAVLEQFFARHVSLNMMSELVLSTLQRGEIARWKPRMGA
RPAV
 
Nucleotide Sequence: 1905 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4352549-4350645 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGACGCGCGCCTGCTCGACTACTACAACCGCGAGCTGGTGTACATGCGCGAGATGGGCGCGGAGTTCG
CCCAGATGTACCCCAAGGTGGCGGGCCGGTTGGGCATGCACGGCACCGAGGTGGCCGACCCCTACGTCGA
GCGCCTGCTGGAAGGGTTCAGTTTCCTGACTGCGCGCATCCACCTGAAGATGGATGCGGAATTTCCCCGC
TTCTCGCAACGCCTGCTGGAAGTGGTGTACCCCAATTATCTTGCGCCCACGCCGGCCATGGCGGTGGTGC
AGTTTTCGCCCAGCATGAATGAGGGCACGCTGGCGCGCGGTTTCGACCTGCCGCGCGGCACGCTGTTGCG
CGGCAGGGTGCCGCGCGGCGAACAGACGTCCTGCGAGTTCATGACCGGGCATGCGGTGCGGCTGTGGCCT
TTGCGCGTGGCCGAGGCCGAGTTCACCGGACCTCCGCCCGACCTGCCGTTGACCCGGCTGGGCCTGGGCG
GCCGTAACGGCCGGGTGCTGAGCGCGCTGCGCATGCGCATCGAGGTGTGCGGCGGCGTGCGGCTGGAAGA
CATGGATCTCGACCAGCTGGTCTTCCATCTGGCAGGGCAGGACCTGCAGATGCAGCGCCTGCTGGAGATC
ATCATGGGGCATACGGTTGCGGTGCTGGGCCACGACAGCGCGCGACCGGTGACTTGGATCAACAAGCTTG
CGCCCACCAGCGTGCGCCATGAAGGGTTCGACGACGAGCAGGCCCTGTTGCCGGCCGACTCGCGCGTCTT
CCAGGGCTACCGCCTGTTGCAGGAATATTTTGCTTTTCCGCGCCGCTATTTATTCTTCAGCCTGAACGAC
CTGAAGCGCGGGCTGCGCACGCCGGCGCTGGCCGGCGGCGAGCGCCGTGAGACGCGCTCGTTCGATTTGA
CGATGCTGTTCTCGACCGCCGCGCCGGAACTGGAAGGGGCGATTGCGGCCGAGCACCTGGCGCTGCACTG
CGCGCCGGTGATCAATTTGTTTCCGAAGCGCGCCGACCGTATCGCGGTGACGCCGCGCACCAATGAATAT
CATCTGGTGGTCGACCGCACACGGCCGCTGGATTATGAGGTGTTCGGCGTGACGCGGGTGGTGGGCCATG
CCTCGGCCGAACGCCCCGAGCAGGAGTTCCGCTCGTTCTACGGCACGCTGGGCAGCGATCCCGACGATTA
CGGCGCCTATTATTCGCTGCGCCGCGAGCCGCGGCTATTGTCGGACCACGCCCAGCGCAACGGCACCCGC
ACCGGCTATACGGGCAGCGAGGTCTTCGTCTCGCTGGTGGATCGCCATGAAGCGCCGTTCTCGGGCCAGC
TGCGCCACTTGACGCTGGAGACGCTGTGCACCAACCGCGATCTGGCGATGCTGCTGCCGCTGGGCACCGA
GACCGACTTCACGTTGCGGGTGTCGGCGCCAGTGGGCGCGGTGAAGGTGCTGCACGGCCCGACACGGCCG
CATACGGCGCTGGCCGAGAATGCCGCCACCTGGCACCTGATCAGCCACCTGGGCCTGAACTACCTGAGCC
TGATCGACCTGGATGCCGAGCAGGGCGCACAGACGCTGCGCGAGATGCTGCATGTATACGGCAACCTGGC
CGATCCGGTGGTGCGCAAGCATATCGGGGGTGTACGGCATGTGCAGGCCGAACCCATGCACCACCGCCTG
CCGGTGCCCGGCCCTATTGTGTACGGGCGCGGAGTGCGCATTGGCCTGCAGGTCGATGAAACGGCGTTTT
CGGGCATCAGTCCGTACCTGTTCGGCGCGGTGCTCGAACAGTTTTTTGCGCGCCATGTGTCACTGAACAT
GATGTCGGAACTGGTGCTGTCTACCTTGCAGCGCGGCGAAATCGCCCGCTGGAAACCCCGCATGGGCGCG
CGCCCCGCGGTTTAG