SecReT6
Protein ID: 163858431
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4113
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4352549..4353109 [-]
Producthypothetical protein
NoteTssE
UniProt IDA9I9G7
KEGG IDbpt:Bpet4113
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-20, Aligned region: 52..163
Protein Sequence: 186 a.a.     [Download]
>gi|163858431|ref|YP_001632729.1| unnamed protein product [Bordetella petrii DSM 12804]
MAQSDTASLRPWDQLPRNERVARDRLQPSLLDRLMDNDPSKRQETRESAMLTHAELRLAVLRDLRWLLNT
VNLQTTDDLSPYRCVPDSTLNFGVRAMAGKRMSEIDWVDVEDSIRNAIASFEPRILDSSVEVRCVTDTGT
LEHHNVLSLEIKGMLWCVPHPMEFLFRTDIDLESGHMDLRDLGGVS
 
Nucleotide Sequence: 561 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4353109-4352549 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCGCAATCCGATACGGCCAGCCTGCGTCCGTGGGATCAGTTGCCGCGCAACGAACGCGTGGCGCGCG
ACCGCTTGCAGCCGTCGTTGCTGGATCGCCTGATGGACAACGATCCGTCCAAGCGCCAGGAAACCCGCGA
ATCGGCCATGCTCACCCATGCCGAGCTGCGCTTGGCGGTGCTGCGCGACCTGCGGTGGCTGCTCAACACG
GTGAATCTGCAGACGACCGACGATTTGTCGCCATACCGATGCGTGCCCGATTCCACTCTGAACTTCGGCG
TGCGGGCGATGGCGGGCAAGCGCATGTCGGAGATCGACTGGGTCGATGTGGAAGACTCGATCCGCAATGC
CATCGCTTCGTTCGAACCGCGCATCCTGGATTCGTCGGTGGAAGTGCGCTGCGTGACCGACACCGGCACG
CTGGAGCATCACAATGTGCTGAGCCTGGAAATCAAGGGAATGCTGTGGTGCGTGCCGCACCCCATGGAAT
TCCTGTTCCGCACCGACATCGATCTGGAAAGCGGCCACATGGACCTGCGCGATCTCGGGGGAGTTTCCTG
A