SecReT6
Protein ID: 163858432
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4114
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4353109..4353924 [-]
Producthypothetical protein
NoteTagJ
UniProt IDA9I9H0
KEGG IDbpt:Bpet4114
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 1.20E-41, Aligned region: 145..269
Protein Sequence: 271 a.a.     [Download]
>gi|163858432|ref|YP_001632730.1| unnamed protein product [Bordetella petrii DSM 12804]
MTKPAVALRESSLSQHLETIQGQIRRQPADADLRAQLFQLMAVQGDWNRASEQLKLCAQLNAQAQPMAML
YEQAIAAERHRESVLAGHAQPVSFGAPPEWFDDLARALSFDAGDPAQAAELRSRAYEAAQARAGRLEGAD
GAAPADFEWISDGDNRLGPVFEFISGGRYGWLPFSALRSVRLLAPEGLCDVVWAQAEITLDDGRTQHGLV
PARYPAPAGQALADLADGIKLGRMTDWQALYGDMYAGVGQKMWVTDQGEYALLDVRGLEMS
 
Nucleotide Sequence: 816 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4353924-4353109 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACCAAACCCGCAGTTGCGCTGCGCGAGAGCAGCTTGTCCCAGCACCTGGAAACGATCCAGGGGCAGA
TACGCCGCCAGCCGGCGGATGCTGACCTGCGTGCGCAGTTGTTCCAGTTGATGGCCGTGCAGGGCGACTG
GAACCGTGCGTCCGAACAATTGAAGCTATGCGCGCAGCTGAATGCCCAGGCCCAGCCCATGGCCATGCTG
TACGAGCAGGCCATCGCGGCCGAGCGGCATCGCGAAAGCGTGCTGGCCGGGCATGCGCAGCCCGTGAGCT
TCGGCGCGCCGCCAGAGTGGTTCGACGATCTGGCGCGGGCGCTGAGTTTCGATGCCGGCGATCCGGCGCA
GGCTGCCGAGTTGCGCAGCCGCGCCTATGAGGCCGCGCAGGCGCGGGCCGGGCGGCTGGAAGGGGCCGAT
GGCGCGGCGCCGGCGGATTTTGAATGGATCAGCGACGGCGATAACCGGCTGGGGCCGGTGTTCGAATTCA
TTTCCGGCGGCCGCTACGGGTGGCTGCCGTTCAGCGCCTTGCGCAGCGTGCGCCTGCTGGCGCCGGAAGG
CTTGTGCGACGTCGTGTGGGCGCAGGCGGAAATCACGCTGGACGATGGGCGGACCCAGCATGGGCTGGTG
CCGGCCCGCTATCCCGCGCCGGCCGGCCAGGCACTGGCCGATCTGGCCGACGGAATCAAGCTGGGCCGCA
TGACCGACTGGCAGGCGCTGTATGGCGACATGTACGCGGGCGTCGGCCAGAAAATGTGGGTAACCGACCA
GGGCGAGTACGCCCTGCTCGATGTGCGCGGGCTGGAGATGAGCTGA