SecReT6
Protein ID: 163858433
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4115
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4354033..4354518 [-]
Producthypothetical protein
NoteTssD
UniProt IDA9I9H3
KEGG IDbpt:Bpet4115
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.60E-38, Aligned region: 6..135
Protein Sequence: 161 a.a.     [Download]
>gi|163858433|ref|YP_001632731.1| unnamed protein product [Bordetella petrii DSM 12804]
MAVDMFMKIDGANGESKDSNHKNWSDIVSFSWGATQPGNMASGGGLGAGKASFNDLHVVARIDKAAPAVM
KHCASGKHLGRVELSVCKAGGQQVEYTKITLEDVLVSSVQLSGEMNSESVVVNYAFQAAKVKQQYWEQTE
QGGKGAESLVAWDIKQNKEVG
 
Nucleotide Sequence: 486 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4354518-4354033 Bordetella petrii DSM 12804 chromosome, complete genome
GTGGCTGTTGACATGTTCATGAAGATCGACGGAGCCAATGGCGAGTCGAAAGATTCCAACCACAAAAACT
GGAGCGATATCGTTTCGTTCTCGTGGGGAGCCACCCAACCCGGCAACATGGCCAGCGGCGGCGGCCTGGG
CGCCGGCAAGGCCAGCTTCAATGACCTGCACGTCGTTGCCCGCATTGACAAGGCGGCTCCTGCCGTCATG
AAGCATTGCGCCAGCGGCAAGCACCTGGGCAGGGTCGAACTGTCGGTGTGCAAGGCAGGCGGCCAGCAAG
TCGAATACACGAAGATCACGTTGGAAGACGTGCTCGTGTCGTCGGTGCAGCTGTCGGGCGAGATGAACTC
GGAATCCGTGGTGGTGAACTACGCCTTCCAGGCCGCCAAGGTCAAACAGCAATACTGGGAGCAAACGGAG
CAGGGCGGCAAGGGCGCGGAAAGCCTGGTCGCCTGGGATATCAAGCAGAACAAGGAAGTGGGCTAA