SecReT6
Protein ID: 163858434
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4116
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4354573..4356075 [-]
Producthypothetical protein
NoteTssC
UniProt IDA9I9H6
KEGG IDbpt:Bpet4116
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.00E-196, Aligned region: 67..493
Protein Sequence: 500 a.a.     [Download]
>gi|163858434|ref|YP_001632732.1| unnamed protein product [Bordetella petrii DSM 12804]
MTAVAKRADARTAETLEADGLSALLKKEFKPKTEQAREAVEHAVRTLAHQALENSGVAVSADAYRTIQAI
IAEIDRKLSDQINLVLHHADFQQLEGAWRGLHYLVTNTETDELLKIRVMCISKKELGRTLKRHKGVGWDQ
SPIFKRVYEEEYGQFGGEPIGCLVGDYHFDHSPPDVELLSEMARISAAAHCPFIAGASPNVMQMDSWQEL
ANPRDLTKIFTNTEYAAWRSLRESEDSRYIGLAMPRFLARLPYGARTNPVDEFDFEEDTDGANHDRYAWA
NSAYAMAANINRSFKLYGWCTSIRGVESGGAVENLPCHTFPTDDGGVDMKCPTEIAISDRREAELAKNGF
MPLVHRKNSDFAAFIGAQSLQKPHEYYDADASANAKLSARLPYLFACCRFAHYLKCIVRDKIGSFRERDD
MERWLNDWIMNYVDGDPVNSSQETKARKPLAAAEVQVQEIEDNPGYYSAKFFLRPHYQLEGLTVSLRLVS
KLPSLKKNDG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4356075-4354573 Bordetella petrii DSM 12804 chromosome, complete genome
ATGACTGCTGTGGCTAAACGCGCGGATGCCCGCACCGCCGAAACACTGGAAGCGGACGGCCTGTCCGCCC
TGCTGAAGAAAGAATTCAAGCCCAAGACCGAACAGGCGCGCGAGGCGGTGGAACACGCCGTGCGCACGCT
GGCGCACCAGGCTCTGGAGAACAGCGGCGTGGCCGTGTCGGCCGACGCCTACCGGACCATTCAGGCGATC
ATCGCCGAGATCGACCGCAAGCTGTCGGACCAGATCAACCTGGTGCTGCACCACGCCGACTTCCAGCAGC
TGGAAGGCGCCTGGCGCGGGCTGCACTATCTGGTGACCAATACCGAGACCGACGAGCTGCTGAAGATTCG
TGTGATGTGCATCTCGAAGAAAGAGCTGGGCCGCACGCTCAAGCGCCACAAGGGCGTGGGCTGGGACCAG
AGCCCCATTTTCAAGCGCGTGTACGAAGAAGAGTACGGCCAGTTCGGCGGCGAGCCTATCGGCTGCCTGG
TGGGCGACTACCACTTCGACCACAGCCCGCCCGACGTGGAGCTGCTGAGCGAAATGGCGCGCATTTCCGC
GGCCGCGCACTGCCCGTTCATCGCGGGCGCTTCGCCCAACGTGATGCAGATGGACTCATGGCAAGAGCTG
GCCAATCCGCGCGACCTGACCAAGATCTTCACCAACACCGAATACGCCGCCTGGCGCAGCCTGCGTGAGT
CGGAAGACTCGCGCTACATCGGACTGGCGATGCCGCGCTTCCTGGCGCGCCTGCCCTACGGCGCGCGCAC
CAATCCGGTTGACGAGTTCGATTTCGAGGAAGACACCGACGGCGCCAACCACGACCGCTACGCCTGGGCC
AACTCGGCCTATGCGATGGCAGCCAACATCAACCGTTCGTTCAAGCTGTACGGCTGGTGCACGTCGATCC
GCGGCGTGGAATCGGGCGGGGCGGTGGAAAACCTGCCGTGCCATACGTTCCCCACCGACGACGGCGGCGT
GGACATGAAGTGCCCCACCGAGATCGCCATCAGCGACCGCCGCGAGGCCGAGCTGGCCAAGAACGGCTTC
ATGCCGCTGGTGCACCGCAAGAATTCCGACTTTGCGGCGTTCATTGGCGCGCAGTCGCTGCAGAAACCGC
ATGAATACTACGACGCCGATGCGTCGGCCAATGCCAAGCTGTCGGCGCGCCTGCCGTACCTGTTCGCGTG
CTGCCGTTTCGCGCACTACCTGAAGTGCATTGTGCGCGACAAGATCGGCTCGTTCCGCGAGCGCGACGAC
ATGGAGCGCTGGTTGAACGACTGGATCATGAATTACGTGGATGGCGATCCGGTTAATTCGTCGCAGGAAA
CCAAGGCCCGCAAGCCGCTGGCCGCAGCCGAAGTCCAGGTGCAGGAAATCGAGGACAACCCCGGCTATTA
CTCCGCCAAGTTTTTCTTGCGGCCGCACTACCAGCTCGAAGGGCTGACGGTGTCGCTGCGCCTTGTGTCC
AAGCTTCCGTCGCTCAAGAAGAACGACGGTTGA