SecReT6
Protein ID: 163858435
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4117
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4356094..4356648 [-]
Producthypothetical protein
NoteTssB
UniProt IDA9I9H9
KEGG IDbpt:Bpet4117
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.80E-59, Aligned region: 13..165
Protein Sequence: 184 a.a.     [Download]
>gi|163858435|ref|YP_001632733.1| unnamed protein product [Bordetella petrii DSM 12804]
MATTLKGSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVLADLAGKSVEPQPDVAERKFLDIDID
NFDERMKSIQPRAAFQVPNTLTGEGNLNVDITFESIDDFSPATVARKVGALNELLDARTQLANLLTYMDG
KTGAEELIGKVLKNPALMNALAAAPNPDAAAPKADEPEADPAAK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4356648-4356094 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGCAACGACACTGAAGGGAAGCGGACAAAAGTTCATTGCGCGCAACCGTGCCCCGCGCGTGCAAATCG
AATACGACGTGGAAATCTACGGCGCGGAACGCAAGATCCAGCTGCCGTTCGTCATGGGCGTGCTGGCCGA
CCTGGCGGGCAAATCGGTCGAGCCGCAGCCTGATGTGGCCGAGCGCAAGTTCCTGGACATCGACATCGAC
AACTTCGACGAGCGCATGAAATCGATCCAGCCGCGGGCCGCGTTCCAGGTGCCCAACACGCTGACCGGCG
AAGGCAACCTGAACGTCGACATCACCTTCGAAAGCATCGACGACTTTTCGCCCGCCACGGTGGCGCGCAA
GGTCGGCGCGCTGAACGAACTGCTGGATGCCCGCACGCAGCTGGCCAACTTGCTGACCTACATGGACGGC
AAGACCGGCGCCGAGGAACTGATCGGCAAGGTGCTGAAGAACCCGGCGCTGATGAATGCGCTGGCGGCCG
CGCCCAACCCGGACGCCGCCGCGCCCAAGGCGGACGAGCCCGAAGCCGATCCGGCCGCGAAGTAA