SecReT6
Protein ID: 163858436
SecReT6 ID251
T6SS typei3
Gene symbol-
Locus tagBpet4118
StrainBordetella petrii DSM 12804
Repliconchromosome [GenBank: NC_010170] [Browse all T6SS(s) in this replicon]
Location [Strand]4356693..4357739 [-]
Producthypothetical protein
NoteTssA
UniProt IDA9I9I2
KEGG IDbpt:Bpet4118
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 52..112
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 184..206
Protein Sequence: 348 a.a.     [Download]
>gi|163858436|ref|YP_001632734.1| unnamed protein product [Bordetella petrii DSM 12804]
MEFADILTALDPRLPCGEDLEYDAEFLQLQQAAVERSEQQFGSTIIPAQPPDWREVEKLSRGLLERTRDV
RIMGYLTQAWTEVRGLPGYADGLTLVADTLERYWEAVHPRLDSVGENDPMPRINALASLGDLAGCARSAR
SSRLVNGVHGQLSLRDAESVLDGSRSDPDFYPGGRARLVEHLRQASLQQDADLAGLLTAMQALRRIQGQV
ADKLGQEWVPDYAGILRTLDVVAQVLVDGGPVASSEEKVGDIAPSVSAAAAPAPNAPAPAVRWQDAQIQS
REEAAAMLAKVCAYFEVNEPSHPAPYLIRRAQQLIAMSFHDIMKNLAPQGLEQFEAWLPRDPNGGPGA
 
Nucleotide Sequence: 1047 bp     [Download]
>gi|163854304|ref|NC_010170.1|:c4357739-4356693 Bordetella petrii DSM 12804 chromosome, complete genome
ATGGAATTTGCCGATATCCTGACCGCGCTGGATCCTCGTCTGCCTTGTGGAGAAGACCTGGAATATGACG
CCGAGTTCCTGCAATTGCAGCAGGCGGCAGTGGAACGCAGCGAACAGCAGTTCGGGTCGACCATCATCCC
GGCTCAACCTCCCGATTGGCGCGAAGTCGAAAAGCTGTCGCGCGGTCTGCTGGAACGCACGCGCGACGTG
CGCATCATGGGTTATCTGACCCAGGCCTGGACCGAAGTCCGCGGCTTGCCGGGTTATGCCGATGGGCTGA
CGCTGGTGGCCGATACCCTCGAACGCTATTGGGAGGCGGTGCATCCTCGCCTGGACAGCGTGGGCGAAAA
CGATCCCATGCCGCGCATCAACGCGCTGGCGTCTTTGGGTGACCTGGCCGGCTGCGCGCGCAGCGCCCGA
TCGAGCCGCCTGGTCAATGGCGTGCACGGGCAACTGTCATTACGCGATGCTGAATCCGTACTGGACGGCA
GCCGTTCCGATCCCGATTTCTATCCGGGCGGACGCGCGCGTTTGGTTGAACATTTGCGCCAGGCATCGCT
GCAGCAGGACGCCGATCTGGCGGGCTTGCTAACTGCGATGCAGGCCTTGCGCCGCATTCAGGGCCAGGTG
GCTGACAAGCTGGGCCAGGAATGGGTGCCGGATTATGCGGGCATCTTGCGTACGCTGGACGTGGTGGCGC
AGGTTCTGGTTGATGGCGGCCCTGTTGCATCGAGCGAAGAAAAAGTCGGGGACATAGCACCTTCGGTCTC
CGCGGCGGCCGCGCCGGCGCCCAATGCGCCGGCCCCCGCGGTGCGCTGGCAAGACGCGCAGATCCAGTCG
CGCGAAGAGGCGGCGGCCATGCTGGCCAAGGTGTGCGCGTATTTCGAGGTGAACGAGCCCAGCCATCCGG
CGCCGTATCTGATTCGCCGGGCGCAGCAACTGATTGCAATGAGCTTTCACGACATCATGAAGAATCTGGC
GCCGCAGGGCCTCGAGCAGTTCGAGGCCTGGCTGCCCAGGGATCCCAACGGCGGCCCTGGCGCTTGA