SecReT6
Protein ID: 167033759
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2760
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3094169..3096010 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDB0KTG7
KEGG IDppg:PputGB1_2760
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-79, Aligned region: 39..347
Phage_base_V [PF04717], Evalue: 6.30E-24, Aligned region: 381..474
Gp5_C [PF06715], Evalue: 5.50E-05, Aligned region: 524..546
DUF4353 [PF14262], Evalue: 0.00078, Aligned region: 513..592
Protein Sequence: 613 a.a.     [Download]
>gi|167033759|ref|YP_001668990.1| unnamed protein product [Pseudomonas putida GB-1]
MIMELASALLSPQNRRLFKFHNLANPEQELLLETFKGVEGLSRAFNYELLLICEDSGVPLKSMMGQHVSI
EIELAEGAPRHITGYLTRFASIGSDGGMARYTATLNPWFSMLKNRFDTRIFQGNTVEEVVTEVFALCPAF
SRHEFRLTRPQKRYTYITQYRETDFNFVQRLLEEEGMFYYFEHTAEGHTMIICDDSSTLVDIPEQPQIRF
HSASVTETADSITQWSGNRQLQSGKMATQTFDYRQPNNRLPVALNSVNKQGDVENFEIYDFPGQYTHGTY
DEGETLLRLRIEALELRGKKFEGASNCRAMKPGYTFELLQHYSHDQGAVEDRQFLLMSVESEGHNNYLSG
QQASYFNTFSCVRKKIPFRPQLSTPRPTIAGPQTAIIVGPPGEEIFTDELGRVKIQFHWDRKGQHNDHSS
CWVRVAQSGASGGFGSIQIPRVGDEVVVVFLDGNPDRPLIMGSLYNSSNTPPWALPANKTQSGFLTRSTK
GKGSNANFFRFEDKAGAEQIIMHAERNLDTEVEADESLKVGGNRTINVEGKHSETIKLETSIAVEEGSYF
VTVDQGAVKIKAATSITLEVGNSKLEMKSDGTITLSGITVDVAGSTIINLNKS
 
Nucleotide Sequence: 1842 bp     [Download]
>gi|167031021|ref|NC_010322.1|:c3096010-3094169 Pseudomonas putida GB-1 chromosome, complete genome
ATGATCATGGAACTGGCCTCCGCGCTGCTATCGCCGCAGAACCGCCGGCTGTTCAAGTTTCACAACCTGG
CCAACCCTGAGCAGGAACTGTTGCTGGAAACCTTCAAGGGCGTCGAGGGCCTTTCGCGGGCGTTCAACTA
CGAACTGCTGCTGATCTGCGAAGACTCTGGCGTGCCGCTTAAATCCATGATGGGCCAGCACGTGAGCATC
GAGATCGAGTTGGCCGAAGGTGCTCCACGCCACATCACCGGTTACCTTACGCGCTTTGCCAGCATTGGCA
GCGATGGCGGCATGGCCCGTTACACCGCCACCCTCAACCCCTGGTTTTCGATGCTGAAGAACCGCTTCGA
CACGCGGATCTTCCAAGGCAACACGGTCGAGGAAGTGGTCACCGAGGTATTCGCCCTGTGTCCGGCTTTC
TCCCGCCACGAGTTCCGCCTGACCCGCCCGCAGAAGCGCTACACCTACATCACCCAGTACCGCGAAACCG
ACTTCAATTTCGTCCAGCGCCTGCTGGAGGAAGAGGGGATGTTCTATTACTTCGAGCACACCGCAGAAGG
CCACACCATGATCATCTGCGATGACTCCAGCACACTGGTGGACATCCCCGAGCAGCCGCAAATCCGTTTC
CACAGCGCCTCGGTTACCGAGACCGCCGACTCCATCACCCAGTGGAGCGGCAACCGCCAGCTGCAGTCCG
GCAAGATGGCCACGCAGACCTTCGATTACCGCCAGCCCAACAACCGCCTGCCGGTGGCGCTGAACAGCGT
GAACAAGCAGGGCGATGTCGAGAACTTCGAGATCTACGACTTCCCCGGTCAGTACACCCACGGCACCTAC
GATGAAGGCGAAACCCTGCTGCGCCTACGTATCGAAGCGCTGGAGCTGCGCGGCAAAAAGTTCGAAGGCG
CCAGTAATTGCCGCGCCATGAAGCCCGGCTATACCTTCGAACTGCTGCAGCACTACAGCCACGATCAAGG
CGCCGTAGAGGACCGACAGTTCCTGCTGATGAGCGTGGAAAGCGAAGGCCACAACAACTACCTCAGCGGC
CAACAGGCGAGCTATTTCAACACGTTCAGTTGCGTGCGCAAGAAGATCCCGTTCCGCCCGCAACTGAGCA
CTCCCCGGCCGACCATCGCCGGCCCGCAGACTGCCATCATCGTTGGCCCACCCGGCGAAGAGATATTCAC
CGACGAACTGGGGCGGGTGAAAATCCAGTTTCACTGGGACCGTAAAGGCCAGCACAACGACCACAGTTCG
TGCTGGGTACGCGTCGCCCAATCCGGCGCCAGTGGCGGCTTCGGCAGCATCCAGATCCCGCGTGTGGGCG
ATGAAGTGGTGGTAGTGTTCCTCGACGGCAACCCGGACCGCCCGTTGATCATGGGCAGCCTGTACAACAG
CAGCAACACCCCGCCGTGGGCACTGCCGGCGAACAAGACCCAGAGTGGGTTCCTGACGCGCTCTACCAAA
GGCAAAGGGTCGAATGCCAACTTCTTCCGCTTCGAAGACAAGGCCGGCGCCGAGCAAATCATCATGCATG
CTGAGCGCAACCTGGATACCGAGGTTGAGGCAGATGAGAGTCTCAAGGTGGGTGGCAATCGAACGATCAA
TGTCGAAGGTAAGCATTCCGAGACGATCAAGCTGGAAACCAGCATTGCGGTGGAAGAGGGGTCGTACTTT
GTGACCGTGGATCAAGGGGCGGTGAAAATTAAGGCGGCAACGTCTATTACGCTTGAGGTCGGAAACAGCA
AGCTGGAGATGAAGTCGGATGGCACGATTACCCTGTCAGGTATCACTGTGGACGTTGCAGGCAGCACGAT
AATTAATCTGAACAAGTCTTGA