SecReT6
Protein ID: 167033763
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2764
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3100524..3101063 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDB0KTH1
KEGG IDppg:PputGB1_2764
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.50E-60, Aligned region: 11..165
Protein Sequence: 179 a.a.     [Download]
>gi|167033763|ref|YP_001668994.1| unnamed protein product [Pseudomonas putida GB-1]
MAKKESTQHKLDRVRAPRVHITYDVDIGDAIEKKELPFVVGVLGDFSGNPLEPLPKLKDRKFVFIDRDNF
NGVLKGIKPRLTYRVDNTLAKNGTQLGVELNFNSLEDFEPQNVVKQVEPLRKLLEVRNKLADLRNKMGGN
DKLEELLMDVLQNTEKLKTLGKEFGREAEVKDPSSSDRA
 
Nucleotide Sequence: 540 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3100524-3101063 Pseudomonas putida GB-1 chromosome, complete genome
ATGGCGAAGAAGGAAAGCACTCAGCACAAACTCGACCGCGTCCGCGCGCCTCGGGTCCATATCACCTACG
ACGTGGACATCGGCGATGCCATCGAGAAAAAGGAGCTGCCCTTCGTCGTCGGCGTACTGGGCGACTTTTC
CGGCAACCCGCTGGAGCCGCTGCCCAAGCTCAAGGACCGCAAGTTCGTCTTCATCGACCGCGACAACTTC
AACGGTGTGCTCAAGGGTATCAAGCCACGCCTGACCTACCGCGTCGACAACACCCTGGCCAAGAACGGCA
CCCAGCTGGGCGTGGAACTGAACTTCAACAGCCTCGAAGACTTCGAGCCACAGAACGTGGTCAAGCAGGT
GGAGCCACTGCGCAAGCTGCTGGAAGTGCGCAACAAACTGGCCGACCTGCGCAACAAGATGGGCGGCAAC
GACAAGCTCGAAGAGCTGCTGATGGACGTGCTGCAAAACACCGAAAAGCTCAAGACCCTGGGCAAGGAAT
TCGGCCGTGAAGCCGAAGTGAAAGACCCATCCAGCAGCGATCGCGCCTGA