SecReT6
Protein ID: 167033764
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2765
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3101078..3102580 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDB0KTH2
KEGG IDppg:PputGB1_2765
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-197, Aligned region: 73..495
Protein Sequence: 500 a.a.     [Download]
>gi|167033764|ref|YP_001668995.1| unnamed protein product [Pseudomonas putida GB-1]
MTDKQTAPQQAGELVEVENFAPQPSLLDSIISQSRVARSDTERNRTRDLIGELVNQVLEGEMTPSKDLIA
VLDSRIAEIDAMLSEQMNEIMHAREFQQLEASWRGLKYQVDQTETSTTLKIHLLNASKKDLVRDLKAASE
FDQSALFKKVYEEEYGTFGGAPFGMLIGDYEFNRNPEDMYLLEEISHVAAAAHAPFISAASPELFGWDSF
TEMSGPRDLAKIFDTVEYAKWKSFRASEDSRYVGLTLPHVLGRLPYGPDTTPVEEFNFVESVDGRDHNKY
LWMNAAYALGTRVTDAFARYGWCVAIRGVEGGGLVEGLPTHTFNTDDGEIALKCPTEIAITDRREKELSD
LGFIPLVHCKGTDYAAFFGTQSAQKQKQYNTDIANANARLSAQLQYIFATSRIAHYMKAIMRDKIGSFAS
RMDVERFLNQWLASYVLLDDTASQEAKAKFPLREARAEVFEVPGKPGVYKAVTYLRPHYQLDELTASLRL
VAELPQGARG
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3101078-3102580 Pseudomonas putida GB-1 chromosome, complete genome
ATGACCGACAAGCAAACCGCACCGCAACAGGCCGGCGAACTGGTCGAAGTGGAAAACTTCGCCCCACAGC
CCTCGCTGCTGGACAGCATCATTTCGCAAAGCCGCGTGGCCCGTTCCGACACCGAGCGCAACCGCACCCG
CGACCTGATCGGCGAACTGGTGAACCAGGTGCTCGAAGGCGAAATGACCCCGAGCAAGGACCTGATCGCC
GTGCTCGATTCGCGTATCGCCGAAATCGACGCGATGCTCTCCGAGCAGATGAACGAAATCATGCACGCTC
GCGAGTTCCAGCAGCTGGAAGCTTCCTGGCGTGGCCTGAAGTACCAGGTAGACCAGACCGAAACCAGCAC
CACGCTGAAGATTCACCTGCTCAATGCCTCGAAGAAAGACCTGGTACGTGACCTGAAGGCCGCCAGCGAA
TTCGACCAGAGCGCACTGTTCAAGAAAGTCTACGAAGAAGAATACGGCACCTTCGGTGGTGCGCCGTTCG
GCATGCTGATCGGCGACTACGAGTTCAACCGCAACCCCGAAGACATGTACCTGCTGGAAGAGATCTCGCA
CGTGGCCGCAGCGGCGCACGCGCCGTTCATCTCCGCCGCCTCCCCTGAACTGTTCGGCTGGGACTCGTTC
ACCGAGATGTCCGGCCCGCGTGACCTGGCGAAGATCTTCGACACCGTCGAATACGCCAAGTGGAAGTCGT
TCCGCGCATCGGAAGACTCCCGCTACGTCGGCCTCACCCTGCCCCACGTGCTCGGCCGCCTGCCGTATGG
CCCCGATACCACGCCGGTGGAGGAATTCAACTTCGTCGAAAGCGTCGACGGCCGCGACCACAACAAGTAC
CTGTGGATGAACGCCGCCTATGCCCTTGGCACCCGCGTCACCGATGCCTTCGCCCGCTACGGCTGGTGCG
TGGCCATCCGCGGCGTGGAAGGGGGCGGCCTGGTCGAAGGCCTGCCGACCCACACCTTCAACACCGACGA
TGGCGAAATCGCCCTCAAGTGCCCTACCGAAATCGCCATTACCGACCGCCGCGAAAAAGAGCTGTCGGAC
CTGGGCTTCATCCCTCTGGTGCACTGCAAGGGCACCGACTATGCCGCCTTCTTCGGCACCCAGTCGGCGC
AGAAGCAAAAGCAGTACAACACCGACATCGCCAATGCCAATGCACGCCTGTCGGCCCAACTGCAATACAT
CTTCGCCACCTCGCGTATCGCCCACTACATGAAGGCGATCATGCGCGACAAGATCGGCAGCTTCGCCTCG
CGCATGGACGTGGAGCGCTTCCTCAACCAGTGGCTGGCCAGCTATGTGCTGCTCGACGATACCGCCAGCC
AGGAAGCCAAGGCCAAGTTCCCGCTGCGTGAGGCCCGCGCCGAGGTGTTCGAGGTGCCAGGCAAGCCAGG
CGTGTACAAGGCCGTCACGTACCTGCGCCCGCACTACCAACTGGACGAACTGACCGCCTCGCTGCGGCTG
GTCGCCGAGCTGCCACAAGGCGCGCGCGGCTGA