SecReT6
Protein ID: 167033765
SecReT6 ID252
T6SS typei4b
Gene symbol-
Locus tagPputGB1_2766
StrainPseudomonas putida GB-1
Repliconchromosome [GenBank: NC_010322] [Browse all T6SS(s) in this replicon]
Location [Strand]3102607..3103089 [+]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDB0KTH3
KEGG IDppg:PputGB1_2766
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.00E-18, Aligned region: 34..136
Protein Sequence: 160 a.a.     [Download]
>gi|167033765|ref|YP_001668996.1| unnamed protein product [Pseudomonas putida GB-1]
MSNQARLLPSLLDRLLDDRPYQSAEPAAQRTCSLAEYKASIVRDLEVLVNTRQSLVAEALDGFSQLGGSI
LEYGMPDFISRSVLDPHDRRLIQQQLERAISTGDRRFRRVRVQLLAQQDGHRMLTFRVDAVLRLQDISRQ
VSFDAVLQVNTQEYKVQNLN
 
Nucleotide Sequence: 483 bp     [Download]
>gi|167031021|ref|NC_010322.1|:3102607-3103089 Pseudomonas putida GB-1 chromosome, complete genome
ATGAGTAACCAGGCCCGCCTGCTGCCCTCGCTGCTCGACCGACTGCTGGACGACCGTCCCTATCAGTCGG
CCGAGCCGGCCGCGCAGCGTACCTGCTCGCTGGCCGAGTACAAGGCCAGCATCGTCCGCGACCTGGAAGT
GCTGGTGAATACCCGCCAATCGCTGGTCGCCGAGGCGCTCGACGGTTTCAGCCAACTCGGTGGTTCCATC
CTTGAATACGGCATGCCTGACTTCATCAGCCGCAGCGTGCTCGACCCACACGATCGTCGTCTTATTCAGC
AGCAGCTGGAGCGTGCGATAAGCACCGGCGACCGGCGCTTTCGCCGGGTCCGTGTGCAGCTCTTGGCCCA
GCAGGACGGCCACCGCATGTTGACCTTCCGCGTGGACGCCGTGTTGCGTCTGCAGGACATCAGCCGCCAG
GTGTCGTTCGACGCCGTGCTGCAGGTCAACACCCAGGAATACAAAGTGCAGAACCTCAACTGA